Myotis lucifugus (little brown bat): 102419083 Help Entry 102419083         CDS       T07795                                  Name (RefSeq) protein kinase C gamma type-like   KO K19663   classical protein kinase C gamma type [EC:2.7.11.13] Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01521   EGFR tyrosine kinase inhibitor resistance mlf04010   MAPK signaling pathway mlf04012   ErbB signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04020   Calcium signaling pathway mlf04066   HIF-1 signaling pathway mlf04070   Phosphatidylinositol signaling system mlf04071   Sphingolipid signaling pathway mlf04082   Neuroactive ligand signaling mlf04150   mTOR signaling pathway mlf04270   Vascular smooth muscle contraction mlf04310   Wnt signaling pathway mlf04370   VEGF signaling pathway mlf04510   Focal adhesion mlf04540   Gap junction mlf04613   Neutrophil extracellular trap formation mlf04650   Natural killer cell mediated cytotoxicity mlf04666   Fc gamma R-mediated phagocytosis mlf04670   Leukocyte transendothelial migration mlf04713   Circadian entrainment mlf04720   Long-term potentiation mlf04723   Retrograde endocannabinoid signaling mlf04724   Glutamatergic synapse mlf04725   Cholinergic synapse mlf04726   Serotonergic synapse mlf04727   GABAergic synapse mlf04728   Dopaminergic synapse mlf04730   Long-term depression mlf04750   Inflammatory mediator regulation of TRP channels mlf04911   Insulin secretion mlf04916   Melanogenesis mlf04918   Thyroid hormone synthesis mlf04919   Thyroid hormone signaling pathway mlf04921   Oxytocin signaling pathway mlf04925   Aldosterone synthesis and secretion mlf04928   Parathyroid hormone synthesis, secretion and action mlf04929   GnRH secretion mlf04935   Growth hormone synthesis, secretion and action mlf04960   Aldosterone-regulated sodium reabsorption mlf04961   Endocrine and other factor-regulated calcium reabsorption mlf04970   Salivary secretion mlf04971   Gastric acid secretion mlf04972   Pancreatic secretion mlf05017   Spinocerebellar ataxia mlf05022   Pathways of neurodegeneration - multiple diseases mlf05031   Amphetamine addiction mlf05032   Morphine addiction mlf05143   African trypanosomiasis mlf05146   Amoebiasis mlf05161   Hepatitis B mlf05163   Human cytomegalovirus infection mlf05170   Human immunodeficiency virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05205   Proteoglycans in cancer mlf05206   MicroRNAs in cancer mlf05207   Chemical carcinogenesis - receptor activation mlf05214   Glioma mlf05223   Non-small cell lung cancer mlf05225   Hepatocellular carcinoma mlf05231   Choline metabolism in cancer mlf05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102419083    04012 ErbB signaling pathway     102419083    04014 Ras signaling pathway     102419083    04015 Rap1 signaling pathway     102419083    04310 Wnt signaling pathway     102419083    04370 VEGF signaling pathway     102419083    04066 HIF-1 signaling pathway     102419083    04020 Calcium signaling pathway     102419083    04070 Phosphatidylinositol signaling system     102419083    04071 Sphingolipid signaling pathway     102419083    04150 mTOR signaling pathway     102419083   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102419083  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102419083    04540 Gap junction     102419083  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102419083    04650 Natural killer cell mediated cytotoxicity     102419083    04666 Fc gamma R-mediated phagocytosis     102419083    04670 Leukocyte transendothelial migration     102419083   09152 Endocrine system    04911 Insulin secretion     102419083    04929 GnRH secretion     102419083    04921 Oxytocin signaling pathway     102419083    04935 Growth hormone synthesis, secretion and action     102419083    04918 Thyroid hormone synthesis     102419083    04919 Thyroid hormone signaling pathway     102419083    04928 Parathyroid hormone synthesis, secretion and action     102419083    04916 Melanogenesis     102419083    04925 Aldosterone synthesis and secretion     102419083   09153 Circulatory system    04270 Vascular smooth muscle contraction     102419083   09154 Digestive system    04970 Salivary secretion     102419083    04971 Gastric acid secretion     102419083    04972 Pancreatic secretion     102419083   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102419083    04961 Endocrine and other factor-regulated calcium reabsorption     102419083   09156 Nervous system    04724 Glutamatergic synapse     102419083    04727 GABAergic synapse     102419083    04725 Cholinergic synapse     102419083    04728 Dopaminergic synapse     102419083    04726 Serotonergic synapse     102419083    04720 Long-term potentiation     102419083    04730 Long-term depression     102419083    04723 Retrograde endocannabinoid signaling     102419083   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102419083   09159 Environmental adaptation    04713 Circadian entrainment     102419083  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102419083    05206 MicroRNAs in cancer     102419083    05205 Proteoglycans in cancer     102419083    05207 Chemical carcinogenesis - receptor activation     102419083    05231 Choline metabolism in cancer     102419083   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102419083    05214 Glioma     102419083    05223 Non-small cell lung cancer     102419083   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102419083    05161 Hepatitis B     102419083    05171 Coronavirus disease - COVID-19     102419083    05163 Human cytomegalovirus infection     102419083   09174 Infectious disease: parasitic    05146 Amoebiasis     102419083    05143 African trypanosomiasis     102419083   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     102419083    05022 Pathways of neurodegeneration - multiple diseases     102419083   09165 Substance dependence    05031 Amphetamine addiction     102419083    05032 Morphine addiction     102419083   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102419083   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102419083  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mlf01001]     102419083 Enzymes [BR:mlf01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      102419083 Protein kinases [BR:mlf01001]  Serine/threonine kinases: AGC group   PKC family [OT]    102419083 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C1_1 C2 ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  102419083 NCBI-ProteinID:  XP_023604913 LinkDB All DBs Position Unknown AA seq 560 aa AA seqDB search DPRNKHKFRLHSYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHT ERRGRLQLEIRAPTADEIHITVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTV KATLNPVWNETFVLSLRYPDPASPRKAQPAPPAPHPYTPEHLLVLGLQFPEGPGAPSLAF LRGSCLKACNYPLELYERVRMGPSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVL GKGSFGKVMLAERRGSEELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFL TQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGII YRDLKLDNVMLDAEGHIKITDFGMCKENVFPGNTTRTFCGTPDYIAPEIIAYQPYGKSVD WWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGVRAPTPRWS PLARQAPRCRPPGLPTQPLCIAIRKGAPTPQLCFHLLETVYITQRFVRTIIDCPLPTPLP PFKHGPCPTRLCRPHSPGWR NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt gacccccggaacaagcacaagttccgcctgcacagctacagcagcccgaccttctgcgac cactgcggctccctgctgtacgggctggtgcaccagggcatgaagtgctcctgttgcgag atgaacgtgcaccggcgctgtgtgcgcagcgtgccctccctgtgcggcgtggaccacacg gagcgccgcgggcgcctgcagctggaaatccgagctccgacggcggatgagatccacatc acggtcggcgaggcccgcaacctcatccccatggaccccaacggtctgtccgacccctat gtgaaactgaagctcatcccagaccctcggaacctgacaaaacagaagacccggacagtg aaagccacgctgaaccctgtgtggaacgagacctttgtgttaagtttgaggtacccggac ccggcttccccacggaaagcccagcccgcgccccccgccccccacccctacacgcccgaa cacctactggtcctgggactacaattcccagaaggccctggggctccttccttggctttt ctaaggggctcctgcctcaaggcctgtaactaccccctggaactctatgagcgggtgcgg atgggtccttcctcccccatcccctccccgtcccctagtcccaccgactccaagcgctgc ttcttcggggcaagcccaggacgcctgcacatctccgacttcagcttcctcatggttctc ggaaaaggcagcttcgggaaggtgatgctggcggagcggaggggctccgaggagctctac gccatcaagatcctgaagaaagacgtgatcgtccaggatgacgacgtggactgcaccctg gtggagaagcgcgtgctggctctggggggccgaggcccggggggccgcccccacttcctc acccagctccactccaccttccagaccccggatcgcctgtattttgtgatggagtatgtc accgggggcgacttgatgtaccacattcagcagctgggcaagtttaaggagccccatgca gcgttctacgccgcagaaatcgccatcggcctcttcttccttcacaatcagggcatcatc taccgggacctgaaactggacaacgtgatgctggatgccgagggacacatcaaaatcacc gacttcggcatgtgtaaggagaacgtcttccccgggaacacgacccgcaccttctgcggg accccagactacatagcccccgagatcattgcctaccagccctatgggaagtctgtcgac tggtggtcctttggggttctactgtatgagatgttggcgggacagcccccctttgacggc gaggacgaggaggagctgttccaggccatcatggaacaaaccgtcacctaccccaagtcg ctctcccgggaagctgtggccatctgcaagggggtgagagccccgactcccagatggtcc ccactcgcacgccaggcgccccgctgccgccctccggggctgcccacgcagccgctgtgc atagctattagaaagggggctcccacccctcaactctgtttccacctgctggaaaccgtt tatataacacagcggtttgttaggacaataattgactgcccactgccaacccccctcccc ccgttcaagcatggcccctgtcccacccgcctctgccgcccccactccccgggctggaga tag

DBGET integrated database retrieval system