Myotis lucifugus (little brown bat): 102422986 Help Entry 102422986         CDS       T07795                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03083   Polycomb repressive complex mlf04010   MAPK signaling pathway mlf05200   Pathways in cancer mlf05202   Transcriptional misregulation in cancer mlf05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     102422986 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102422986 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102422986 (MAX)    05202 Transcriptional misregulation in cancer     102422986 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     102422986 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlf03000]     102422986 (MAX)    03036 Chromosome and associated proteins [BR:mlf03036]     102422986 (MAX) Transcription factors [BR:mlf03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     102422986 (MAX) Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      102422986 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 Csm1_N Motif Other DBs NCBI-GeneID:  102422986 NCBI-ProteinID:  XP_006091035 Ensembl:  ENSMLUG00000004318 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSS DNSLYTNAKGSAISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaagcgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaagcaacaggca tcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaac cacacacaccagcaagatattgatgacctcaagcggcagaatgcccttctggagcagcaa gtccgtgcactggagaaagcgaggtcgagtgcccaactgcagaccaactacccttcctca gacaacagcctctacaccaacgccaagggcagcgccatctctgccttcgatgggggctcg gactccagctcagagtcggagcctgaagagccccaaagcaggaagaaactccggatggag gccagctaa

DBGET integrated database retrieval system