Myotis lucifugus (little brown bat): 102431174 Help Entry 102431174         CDS       T07795                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04061   Viral protein interaction with cytokine and cytokine receptor mlf04068   FoxO signaling pathway mlf04148   Efferocytosis mlf04625   C-type lectin receptor signaling pathway mlf04630   JAK-STAT signaling pathway mlf04660   T cell receptor signaling pathway mlf04672   Intestinal immune network for IgA production mlf05133   Pertussis mlf05135   Yersinia infection mlf05140   Leishmaniasis mlf05142   Chagas disease mlf05143   African trypanosomiasis mlf05144   Malaria mlf05145   Toxoplasmosis mlf05146   Amoebiasis mlf05150   Staphylococcus aureus infection mlf05152   Tuberculosis mlf05310   Asthma mlf05320   Autoimmune thyroid disease mlf05321   Inflammatory bowel disease mlf05322   Systemic lupus erythematosus mlf05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102431174 (IL10)    04068 FoxO signaling pathway     102431174 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102431174 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     102431174 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102431174 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102431174 (IL10)    04660 T cell receptor signaling pathway     102431174 (IL10)    04672 Intestinal immune network for IgA production     102431174 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102431174 (IL10)    05133 Pertussis     102431174 (IL10)    05150 Staphylococcus aureus infection     102431174 (IL10)    05152 Tuberculosis     102431174 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     102431174 (IL10)    05144 Malaria     102431174 (IL10)    05145 Toxoplasmosis     102431174 (IL10)    05140 Leishmaniasis     102431174 (IL10)    05142 Chagas disease     102431174 (IL10)    05143 African trypanosomiasis     102431174 (IL10)   09163 Immune disease    05310 Asthma     102431174 (IL10)    05322 Systemic lupus erythematosus     102431174 (IL10)    05320 Autoimmune thyroid disease     102431174 (IL10)    05321 Inflammatory bowel disease     102431174 (IL10)    05330 Allograft rejection     102431174 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102431174 (IL10)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102431174 (IL10) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102431174 (IL10) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    102431174 (IL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 Motif Other DBs NCBI-GeneID:  102431174 NCBI-ProteinID:  XP_006094927 Ensembl:  ENSMLUG00000017715 UniProt:  G1PXI6 LinkDB All DBs Position Unknown AA seq 178 aa AA seqDB search MPSSALLCCLVFLAGMGASPAQGTPSENSCTHFSTSLPHMLRELRAAFSRVKTFFQMKDQ LDNMLLNGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAESQGPDIKEPVSSLGEKLKTLR LQLRRCHRFLPCENKSKAVEQVKSAFSKLQERGVYKAMSEFDIFINYIEAYMTMKMKK NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagctcagcactgctctgttgcctggtcttcctggctgggatgggggccagccca gcccagggcacgccatctgagaacagctgcacccacttctccaccagcctgccccacatg ctccgagagctccgagctgccttcagcagggtgaagactttctttcaaatgaaggaccag ctggacaacatgctgttgaacgggtctttgctggaggacttcaagggttacctgggttgc caagccttgtccgagatgatccagttttacctggaagaggtgatgccccaggccgagagc cagggcccggacatcaaggagcccgtgagctcgctgggggagaagctgaagacgctgagg ctgcagctgcggcgctgtcatcgctttctgccctgtgagaataagagcaaagccgtggag caggtgaagagcgccttcagtaagctccaggagagaggggtctacaaagccatgagtgag tttgacatcttcatcaactacatagaggcctacatgacaatgaagatgaaaaaatga

DBGET integrated database retrieval system