Myotis lucifugus (little brown bat): 102431403 Help Entry 102431403         CDS       T07795                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03420   Nucleotide excision repair mlf04066   HIF-1 signaling pathway mlf04110   Cell cycle mlf04114   Oocyte meiosis mlf04120   Ubiquitin mediated proteolysis mlf04141   Protein processing in endoplasmic reticulum mlf04310   Wnt signaling pathway mlf04350   TGF-beta signaling pathway mlf04710   Circadian rhythm mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102431403 (RBX1)    04120 Ubiquitin mediated proteolysis     102431403 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     102431403 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102431403 (RBX1)    04350 TGF-beta signaling pathway     102431403 (RBX1)    04066 HIF-1 signaling pathway     102431403 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102431403 (RBX1)    04114 Oocyte meiosis     102431403 (RBX1)  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     102431403 (RBX1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102431403 (RBX1)   09162 Cancer: specific types    05211 Renal cell carcinoma     102431403 (RBX1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102431403 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mlf04121]     102431403 (RBX1)    03400 DNA repair and recombination proteins [BR:mlf03400]     102431403 (RBX1) Enzymes [BR:mlf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102431403 (RBX1) Ubiquitin system [BR:mlf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102431403 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      102431403 (RBX1)    Cul2 complex      102431403 (RBX1)    Cul3 complex      102431403 (RBX1)    Cul4 complex      102431403 (RBX1)    Cul7 complex      102431403 (RBX1)    Cul8 complex      102431403 (RBX1)    Cul9 complex      102431403 (RBX1) DNA repair and recombination proteins [BR:mlf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102431403 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       102431403 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  102431403 NCBI-ProteinID:  XP_006098598 Ensembl:  ENSMLUG00000007815 UniProt:  G1PA33 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaacgcagtagccctctgggcctgggacattgtggttgat aactgtgccatctgcaggaaccacattatggacctttgcatagaatgtcaggcgaaccag gcatctgccacttctgaagagtgcaccgttgcgtggggagtctgtaatcatgcttttcac ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccgctggacaacagagag tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system