Myotis lucifugus (little brown bat): 102431882 Help Entry 102431882         CDS       T07795                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01521   EGFR tyrosine kinase inhibitor resistance mlf01523   Antifolate resistance mlf04060   Cytokine-cytokine receptor interaction mlf04061   Viral protein interaction with cytokine and cytokine receptor mlf04066   HIF-1 signaling pathway mlf04068   FoxO signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04218   Cellular senescence mlf04620   Toll-like receptor signaling pathway mlf04621   NOD-like receptor signaling pathway mlf04623   Cytosolic DNA-sensing pathway mlf04625   C-type lectin receptor signaling pathway mlf04630   JAK-STAT signaling pathway mlf04640   Hematopoietic cell lineage mlf04657   IL-17 signaling pathway mlf04659   Th17 cell differentiation mlf04668   TNF signaling pathway mlf04672   Intestinal immune network for IgA production mlf04931   Insulin resistance mlf04932   Non-alcoholic fatty liver disease mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04936   Alcoholic liver disease mlf05010   Alzheimer disease mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05132   Salmonella infection mlf05133   Pertussis mlf05134   Legionellosis mlf05135   Yersinia infection mlf05142   Chagas disease mlf05143   African trypanosomiasis mlf05144   Malaria mlf05146   Amoebiasis mlf05152   Tuberculosis mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05166   Human T-cell leukemia virus 1 infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05202   Transcriptional misregulation in cancer mlf05321   Inflammatory bowel disease mlf05323   Rheumatoid arthritis mlf05332   Graft-versus-host disease mlf05410   Hypertrophic cardiomyopathy mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102431882 (IL6)    04668 TNF signaling pathway     102431882 (IL6)    04066 HIF-1 signaling pathway     102431882 (IL6)    04068 FoxO signaling pathway     102431882 (IL6)    04151 PI3K-Akt signaling pathway     102431882 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102431882 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     102431882 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102431882 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102431882 (IL6)    04620 Toll-like receptor signaling pathway     102431882 (IL6)    04621 NOD-like receptor signaling pathway     102431882 (IL6)    04623 Cytosolic DNA-sensing pathway     102431882 (IL6)    04625 C-type lectin receptor signaling pathway     102431882 (IL6)    04659 Th17 cell differentiation     102431882 (IL6)    04657 IL-17 signaling pathway     102431882 (IL6)    04672 Intestinal immune network for IgA production     102431882 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102431882 (IL6)    05202 Transcriptional misregulation in cancer     102431882 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102431882 (IL6)    05161 Hepatitis B     102431882 (IL6)    05171 Coronavirus disease - COVID-19     102431882 (IL6)    05164 Influenza A     102431882 (IL6)    05162 Measles     102431882 (IL6)    05168 Herpes simplex virus 1 infection     102431882 (IL6)    05163 Human cytomegalovirus infection     102431882 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     102431882 (IL6)    05169 Epstein-Barr virus infection     102431882 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     102431882 (IL6)    05135 Yersinia infection     102431882 (IL6)    05133 Pertussis     102431882 (IL6)    05134 Legionellosis     102431882 (IL6)    05152 Tuberculosis     102431882 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     102431882 (IL6)    05144 Malaria     102431882 (IL6)    05142 Chagas disease     102431882 (IL6)    05143 African trypanosomiasis     102431882 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     102431882 (IL6)    05321 Inflammatory bowel disease     102431882 (IL6)    05332 Graft-versus-host disease     102431882 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     102431882 (IL6)    05020 Prion disease     102431882 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     102431882 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102431882 (IL6)    05410 Hypertrophic cardiomyopathy     102431882 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102431882 (IL6)    04932 Non-alcoholic fatty liver disease     102431882 (IL6)    04931 Insulin resistance     102431882 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     102431882 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102431882 (IL6)    01523 Antifolate resistance     102431882 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102431882 (IL6) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102431882 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 DUF4924 Motif Other DBs NCBI-GeneID:  102431882 NCBI-ProteinID:  XP_006088874 Ensembl:  ENSMLUG00000015855 UniProt:  G1PT99 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MNSLSTNTFSSVAFSLGLLLVMTTAFPTPVPRGEDSKDDTTSNRPLLTSSEQIENLIKSI LLEISDVKNKMCDNHESCKNSKEVLTENNLNLPKLARKDGCFHSGFNQETCLIRITTGLL EFQVYLEYIQNTFEGHAQAMKIGTKALVNILRQKMKNPVEETIPDPTTNTGLLEKMHAQK NWLKTTTIHLILRSLEDFLQFTQRAIRM NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgaactccctctccacaaacaccttcagttcagtggccttctccctggggctgctcctg gtgatgactactgctttccctaccccggttccccggggagaagattctaaagatgatacc acctcaaatagaccactactcacctcttcagaacaaattgaaaacctcattaagtccatc ctcctcgaaatctctgacgtgaaaaataagatgtgtgacaaccatgaatcgtgtaaaaac agcaaggaagtactgacagaaaacaacctgaaccttccaaaactggccagaaaagatgga tgcttccattctggattcaatcaggagacctgcttgataagaatcaccaccggtcttctg gagtttcaggtatacctggagtacatccagaacacatttgagggacatgcccaggccatg aagataggaaccaaagccctggtcaatatcctgaggcaaaagatgaagaaccccgttgaa gaaaccatccctgacccaaccacaaacactggcctgctggagaagatgcatgcacagaaa aactggctgaagaccacgacgattcacctcatcctgcgaagcctcgaggacttcctacag ttcactcagagggctatccggatgtag

DBGET integrated database retrieval system