Myotis lucifugus (little brown bat): 102431941 Help Entry 102431941         CDS       T07795                                  Symbol CD209 Name (RefSeq) CD209 antigen isoform X2   KO K06563   C-type lectin domain family 4 member L/M Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03260   Virion - Human immunodeficiency virus mlf03264   Virion - Flavivirus and Alphavirus mlf03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mlf03273   Virion - Lassa virus and SFTS virus mlf04145   Phagosome mlf04625   C-type lectin receptor signaling pathway mlf05152   Tuberculosis mlf05162   Measles Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     102431941 (CD209)    03264 Virion - Flavivirus and Alphavirus     102431941 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     102431941 (CD209)    03273 Virion - Lassa virus and SFTS virus     102431941 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102431941 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102431941 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     102431941 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     102431941 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102431941 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mlf04054]     102431941 (CD209)    04090 CD molecules [BR:mlf04090]     102431941 (CD209)    04091 Lectins [BR:mlf04091]     102431941 (CD209) Membrane trafficking [BR:mlf04131]  Endocytosis   Phagocytosis    C-lectin receptors     102431941 (CD209) Pattern recognition receptors [BR:mlf04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    102431941 (CD209) CD molecules [BR:mlf04090]  Proteins   102431941 (CD209) Lectins [BR:mlf04091]  C-Type lectins   Asialoglycoprotein and DC receptors    102431941 (CD209) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C UL45 Motif Other DBs NCBI-GeneID:  102431941 NCBI-ProteinID:  XP_006101959 Ensembl:  ENSMLUG00000028703 LinkDB All DBs Position Unknown AA seq 253 aa AA seqDB search MAEMCVPKEPGGPDEAEPPLWEEREIFQGQRSSEKDPGLSRSSRSLPECLTRAPLLLILL LISLGLFMLMLITLIQVSRIQQSLPREVDDQESHSPVVVLQSDLEEILHQLSRMNATLTG LCRRCPWNWDFFQGSCYIFSKIQSTWDASVSACEDMRAQLVVINNAEEQKFLKSWDIRND KSTWIGLSDKHNEGSWQWVDNTHLHLSFWKEGEPNNQGEEDCVELSGDGWNDNKCSEEHF WICEKPSALCPGL NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atggcagagatgtgtgtccccaaggaaccaggtggccctgatgaggctgagcccccatta tgggaggagagggagatatttcaaggccagagatcatctgagaaagaccctgggctgtcg aggagctcaagaagtttgccagagtgtctaacccgggcccctctgcttctgatactgctc ctcatctctttgggtctcttcatgctcatgctgatcaccctgattcaagtctccaggatc caacaatccctgccaagagaggtggatgatcaggagagccacagcccggtggttgttttg caatcagacctggaggagatcctccatcagctgagcaggatgaatgccaccctgactggc ctgtgccgtcgctgcccctggaattgggacttcttccagggaagctgttatatcttctcc aagattcagagcacctgggatgcttctgtctctgcctgtgaggacatgagggcccagcta gtggtcattaacaatgctgaggagcagaaattcctgaaatcttgggatatcagaaatgat aaaagcacctggatcggcctcagtgacaaacacaatgaagggtcctggcaatgggtggac aacacccacttacatctcagcttctggaaagaaggggaacctaacaatcaaggagaggag gactgtgtggaactgtccggtgatggctggaatgataacaaatgtagtgaagaacacttc tggatctgcgagaagccctctgctctgtgcccaggcctctga

DBGET integrated database retrieval system