Myotis lucifugus (little brown bat): 102437928 Help Entry 102437928         CDS       T07795                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04151   PI3K-Akt signaling pathway mlf04630   JAK-STAT signaling pathway mlf04640   Hematopoietic cell lineage mlf04657   IL-17 signaling pathway mlf04658   Th1 and Th2 cell differentiation mlf04659   Th17 cell differentiation mlf04660   T cell receptor signaling pathway mlf04664   Fc epsilon RI signaling pathway mlf04672   Intestinal immune network for IgA production mlf05140   Leishmaniasis mlf05200   Pathways in cancer mlf05310   Asthma mlf05320   Autoimmune thyroid disease mlf05321   Inflammatory bowel disease mlf05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102437928 (IL4)    04151 PI3K-Akt signaling pathway     102437928 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102437928 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102437928 (IL4)    04660 T cell receptor signaling pathway     102437928 (IL4)    04658 Th1 and Th2 cell differentiation     102437928 (IL4)    04659 Th17 cell differentiation     102437928 (IL4)    04657 IL-17 signaling pathway     102437928 (IL4)    04664 Fc epsilon RI signaling pathway     102437928 (IL4)    04672 Intestinal immune network for IgA production     102437928 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102437928 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102437928 (IL4)   09163 Immune disease    05310 Asthma     102437928 (IL4)    05320 Autoimmune thyroid disease     102437928 (IL4)    05321 Inflammatory bowel disease     102437928 (IL4)    05330 Allograft rejection     102437928 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102437928 (IL4)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102437928 (IL4) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102437928 (IL4) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    102437928 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 FUSC-like Motif Other DBs NCBI-GeneID:  102437928 NCBI-ProteinID:  XP_006100237 Ensembl:  ENSMLUG00000016579 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MGLTSQLIPALICLLACTSNFTHGRKYNTLQETIKMLNVLTAKKDPRCMELTVSDVLAAP KNTTEKETLCRAATVLRQVYRHHKCLTRILSGLDRNLSSMANKTSCPVNEAKKRTLKDFL ERLKTIMQEKYSKGGSWTF NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacgtcccaactgattccagctctgatctgcttactagcatgtaccagcaac ttcacccacggacgcaagtacaacaccttacaagagaccatcaaaatgctgaacgtcctc acagcgaaaaaggatccacggtgcatggagctgaccgtatcagacgtcttggctgcccca aagaacacaactgagaaggaaaccttgtgcagggccgcgacggtgcttcggcaggtctac aggcaccacaagtgcttgaccagaatattgagcggacttgacaggaacctcagcagcatg gccaacaagacctcctgtcctgtgaacgaagccaagaagaggacactgaaagacttcttg gaaaggttaaagaccatcatgcaagagaaatactcaaagggtggaagctggacattttaa

DBGET integrated database retrieval system