Myotis lucifugus (little brown bat): 102441232 Help Entry 102441232         CDS       T07795                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04010   MAPK signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04024   cAMP signaling pathway mlf04062   Chemokine signaling pathway mlf04510   Focal adhesion mlf04520   Adherens junction mlf04611   Platelet activation mlf04670   Leukocyte transendothelial migration mlf04720   Long-term potentiation mlf04722   Neurotrophin signaling pathway mlf04934   Cushing syndrome mlf04972   Pancreatic secretion mlf05211   Renal cell carcinoma mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102441232 (RAP1B)    04014 Ras signaling pathway     102441232 (RAP1B)    04015 Rap1 signaling pathway     102441232 (RAP1B)    04024 cAMP signaling pathway     102441232 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102441232 (RAP1B)    04520 Adherens junction     102441232 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102441232 (RAP1B)    04670 Leukocyte transendothelial migration     102441232 (RAP1B)    04062 Chemokine signaling pathway     102441232 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     102441232 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     102441232 (RAP1B)    04722 Neurotrophin signaling pathway     102441232 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     102441232 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102441232 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102441232 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102441232 (RAP1B)    04031 GTP-binding proteins [BR:mlf04031]     102441232 (RAP1B) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102441232 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    102441232 (RAP1B)   Exosomal proteins of colorectal cancer cells    102441232 (RAP1B) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     102441232 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  102441232 NCBI-ProteinID:  XP_006097949 Ensembl:  ENSMLUG00000016606 UniProt:  G1PUZ6 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatccgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system