Myotis lucifugus (little brown bat): 106696100
Help
Entry
106696100 CDS
T07795
Symbol
IGFBP3
Name
(RefSeq) insulin-like growth factor-binding protein 3
KO
K10138
insulin-like growth factor-binding protein 3
Organism
mlf
Myotis lucifugus (little brown bat)
Pathway
mlf04115
p53 signaling pathway
mlf04218
Cellular senescence
mlf04935
Growth hormone synthesis, secretion and action
mlf05202
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:
mlf00001
]
09140 Cellular Processes
09143 Cell growth and death
04115 p53 signaling pathway
106696100 (IGFBP3)
04218 Cellular senescence
106696100 (IGFBP3)
09150 Organismal Systems
09152 Endocrine system
04935 Growth hormone synthesis, secretion and action
106696100 (IGFBP3)
09160 Human Diseases
09161 Cancer: overview
05202 Transcriptional misregulation in cancer
106696100 (IGFBP3)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
mlf04131
]
106696100 (IGFBP3)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
mlf04147
]
106696100 (IGFBP3)
Membrane trafficking [BR:
mlf04131
]
Endocytosis
Others
Insulin-like growth factor-binding proteins
106696100 (IGFBP3)
Exosome [BR:
mlf04147
]
Exosomal proteins
Exosomal proteins of other cancer cells
106696100 (IGFBP3)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Thyroglobulin_1
Motif
Other DBs
NCBI-GeneID:
106696100
NCBI-ProteinID:
XP_023605204
LinkDB
All DBs
Position
Unknown
AA seq
212 aa
AA seq
DB search
MTWPSGRRRAVRTQREQGPPHRPRARGRPAQPGKEQRVTIPRRRDLARPSAPARVPPGNG
DESEEELSTVTEESPVLTHWAPASRFHPGHPKMDAIRRGSAKDSQRYRVHLEDQGPVTQN
FSSASKQVTEYRPCRREMEDMLILLKSLSTLNPRGIHLPNCDKKGFYKKKQCRPARGRKR
GLCWCVDKYGQPLPGHDPSGKLDVHCDSVESQ
NT seq
639 nt
NT seq
+upstream
nt +downstream
nt
atgacgtggccatctggccgccgccgggctgtgcggacccagcgggagcagggacccccc
caccggccccgggcccgcggccgcccggctcagccggggaaggagcagcgagtgacgatt
ccccggagacgtgaccttgctcggccctcagctccggcccgtgtccccccaggaaacggc
gatgagtcggaggaagagctcagcactgtgaccgaggagagcccggtgctgacccactgg
gcccccgcctccaggttccaccccggccaccccaagatggacgcaatcaggagagggagc
gccaaggacagccagcgctacagggtccacctcgaggaccagggcccggtcacccagaac
ttctcctccgcgagcaagcaggtcacggaatacaggccctgccgccgggagatggaggac
atgctgatcctactcaagtccctgagcacattgaacccccggggcatccacctccccaac
tgcgacaagaagggcttctacaagaagaagcagtgccgcccggccaggggcaggaagcgc
ggcttgtgctggtgcgtggacaagtacgggcagcccctccccggccacgacccatccggc
aaactggacgtgcactgtgacagcgtggagagccagtga
DBGET
integrated database retrieval system