Mustela lutreola (European mink): 131813182 Help Entry 131813182         CDS       T09578                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mlk  Mustela lutreola (European mink) Pathway mlk04060   Cytokine-cytokine receptor interaction mlk04151   PI3K-Akt signaling pathway mlk04217   Necroptosis mlk04380   Osteoclast differentiation mlk04620   Toll-like receptor signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04622   RIG-I-like receptor signaling pathway mlk04623   Cytosolic DNA-sensing pathway mlk04630   JAK-STAT signaling pathway mlk04650   Natural killer cell mediated cytotoxicity mlk04668   TNF signaling pathway mlk04936   Alcoholic liver disease mlk05135   Yersinia infection mlk05142   Chagas disease mlk05152   Tuberculosis mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05165   Human papillomavirus infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05168   Herpes simplex virus 1 infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     131813182 (IFNB1)    04668 TNF signaling pathway     131813182 (IFNB1)    04151 PI3K-Akt signaling pathway     131813182 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131813182 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131813182 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131813182 (IFNB1)    04621 NOD-like receptor signaling pathway     131813182 (IFNB1)    04622 RIG-I-like receptor signaling pathway     131813182 (IFNB1)    04623 Cytosolic DNA-sensing pathway     131813182 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     131813182 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     131813182 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     131813182 (IFNB1)    05161 Hepatitis B     131813182 (IFNB1)    05160 Hepatitis C     131813182 (IFNB1)    05171 Coronavirus disease - COVID-19     131813182 (IFNB1)    05164 Influenza A     131813182 (IFNB1)    05162 Measles     131813182 (IFNB1)    05168 Herpes simplex virus 1 infection     131813182 (IFNB1)    05163 Human cytomegalovirus infection     131813182 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     131813182 (IFNB1)    05169 Epstein-Barr virus infection     131813182 (IFNB1)    05165 Human papillomavirus infection     131813182 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     131813182 (IFNB1)    05152 Tuberculosis     131813182 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     131813182 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131813182 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     131813182 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131813182 (IFNB1) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Interferons    131813182 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  131813182 NCBI-ProteinID:  XP_058999438 LinkDB All DBs Position 12:47946924..47947484 Genome browser AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFK IPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLE EILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKL TDSLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgtatcctccaaactgctctcctggtatatttctccaccacggttctt gccatgaactataacttacttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctacagttgaatggaacgtctaaagattgcctcaaggacaggatgaacttcaag atccctgaggagatccagaaatcccagaagttccagaaggaggacatcgtattggtcacc cttgagatgttccaaaagacttctgatattttcaggagaaatctctcaagcacgggatgg aatgagagcattgtcgagaacctccttgccacactccactggcagaaggaacatctggag gaaatcctggaggacatcatgcaggaggaaaacgtcacttgggaccacaggacccttctg cacctgaagagatattatctaaggattgtgcggtacctgaaagcgaaggagttcagcgtc tgtgcctggacaatagtgcaagcagaaatcctcaggagctttttcttccttgataaactt acagattctctccctaactga

DBGET integrated database retrieval system