Mustela lutreola (European mink): 131825586 Help Entry 131825586         CDS       T09578                                  Name (RefSeq) thymosin beta-4-like   KO K05764   thymosin, beta 4 Organism mlk  Mustela lutreola (European mink) Pathway mlk04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mlk00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131825586  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlk04812]     131825586 Cytoskeleton proteins [BR:mlk04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      131825586 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin DUF5545 Motif Other DBs NCBI-GeneID:  131825586 NCBI-ProteinID:  XP_059021033 LinkDB All DBs Position 2:complement(128441040..128446862) Genome browser AA seq 77 aa AA seqDB search MSDKPNMAEIEKFSKLKTKKTEMQEKNPLPSKEAIEQEKKQVNPNEEGATGCDSNARAYR VQSWREQLSSAAHRGCR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcagataaacccaatatggctgagattgagaaattcagtaagttgaaaacgaagaag acagaaatgcaagagaaaaatccactgccttcaaaagaagcaattgaacaggagaagaaa caggtgaatcctaatgaggaaggagcaactggctgcgacagcaatgccagggcttaccgg gtccagagctggagggagcagttgtcctcagcagcgcaccggggctgccgctag

DBGET integrated database retrieval system