Mustela lutreola (European mink): 131828993 Help Entry 131828993         CDS       T09578                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mlk  Mustela lutreola (European mink) Pathway mlk00510   N-Glycan biosynthesis mlk00513   Various types of N-glycan biosynthesis mlk04141   Protein processing in endoplasmic reticulum Module mlk_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mlk00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     131828993    00513 Various types of N-glycan biosynthesis     131828993  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131828993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  131828993 NCBI-ProteinID:  XP_059026289 LinkDB All DBs Position 4:complement(75732881..75733294) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaaccctgctgtcttccctcat ctgaccgtggtgctgttggccattggcatgttctttacggcctggttcttcgtttatgag gttacctccaccaaatacactcgggatatctacaaagagctcctcatctccttggtggcc tcgctcttcatgggttttggagtcctcttcctgctgctctgggttggcatctatgtatga

DBGET integrated database retrieval system