Mustela lutreola (European mink): 131839127 Help Entry 131839127         CDS       T09578                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism mlk  Mustela lutreola (European mink) Pathway mlk03050   Proteasome mlk04060   Cytokine-cytokine receptor interaction mlk04066   HIF-1 signaling pathway mlk04217   Necroptosis mlk04350   TGF-beta signaling pathway mlk04380   Osteoclast differentiation mlk04612   Antigen processing and presentation mlk04630   JAK-STAT signaling pathway mlk04650   Natural killer cell mediated cytotoxicity mlk04657   IL-17 signaling pathway mlk04658   Th1 and Th2 cell differentiation mlk04659   Th17 cell differentiation mlk04660   T cell receptor signaling pathway mlk04940   Type I diabetes mellitus mlk05140   Leishmaniasis mlk05142   Chagas disease mlk05143   African trypanosomiasis mlk05144   Malaria mlk05145   Toxoplasmosis mlk05146   Amoebiasis mlk05152   Tuberculosis mlk05160   Hepatitis C mlk05164   Influenza A mlk05168   Herpes simplex virus 1 infection mlk05200   Pathways in cancer mlk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlk05321   Inflammatory bowel disease mlk05322   Systemic lupus erythematosus mlk05323   Rheumatoid arthritis mlk05330   Allograft rejection mlk05332   Graft-versus-host disease mlk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     131839127 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     131839127 (IFNG)    04630 JAK-STAT signaling pathway     131839127 (IFNG)    04066 HIF-1 signaling pathway     131839127 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131839127 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131839127 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     131839127 (IFNG)    04612 Antigen processing and presentation     131839127 (IFNG)    04660 T cell receptor signaling pathway     131839127 (IFNG)    04658 Th1 and Th2 cell differentiation     131839127 (IFNG)    04659 Th17 cell differentiation     131839127 (IFNG)    04657 IL-17 signaling pathway     131839127 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     131839127 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131839127 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131839127 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     131839127 (IFNG)    05164 Influenza A     131839127 (IFNG)    05168 Herpes simplex virus 1 infection     131839127 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     131839127 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     131839127 (IFNG)    05144 Malaria     131839127 (IFNG)    05145 Toxoplasmosis     131839127 (IFNG)    05140 Leishmaniasis     131839127 (IFNG)    05142 Chagas disease     131839127 (IFNG)    05143 African trypanosomiasis     131839127 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     131839127 (IFNG)    05323 Rheumatoid arthritis     131839127 (IFNG)    05321 Inflammatory bowel disease     131839127 (IFNG)    05330 Allograft rejection     131839127 (IFNG)    05332 Graft-versus-host disease     131839127 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     131839127 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     131839127 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:mlk03051]     131839127 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131839127 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:mlk00536]     131839127 (IFNG) Proteasome [BR:mlk03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     131839127 (IFNG) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Interferons    131839127 (IFNG) Glycosaminoglycan binding proteins [BR:mlk00536]  Heparan sulfate / Heparin   Cytokines    131839127 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma DUF7774 Motif Other DBs NCBI-GeneID:  131839127 NCBI-ProteinID:  XP_059042244 LinkDB All DBs Position 8:complement(102721798..102726778) Genome browser AA seq 166 aa AA seqDB search MNYTNYILAFQLCVIFCSSGYYCQAMFFKEIEDLKEYFNASNPDVADGGPLFLDILKNWR EESDKKIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLVRFFNNSSSKLEDFLKLIR IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSHSVFPGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaaactatatcttagcttttcagctttgcgtgattttctgttcttctggc tattactgtcaggccatgttttttaaagaaatagaagacctaaaggaatattttaatgca agtaatccagatgtagcagatggtgggcctcttttcttagatattttgaagaactggaga gaggagagtgacaaaaaaatcattcaaagccaaattgtctccttctacttgaaactgttt gaaaacttcaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttgtcaggttcttcaataacagcagcagtaagctggaggacttccttaagctgattcga attcccgtgaatgatctgcaggtccagcgcaaagcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatctaacctaaggaagcggaaaaggagtcacagtgtgtttccc ggccgcagagcatcgaaataa

DBGET integrated database retrieval system