Mustela lutreola (European mink): 131839131 Help Entry 131839131         CDS       T09578                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism mlk  Mustela lutreola (European mink) Pathway mlk04010   MAPK signaling pathway mlk04014   Ras signaling pathway mlk04015   Rap1 signaling pathway mlk04024   cAMP signaling pathway mlk04062   Chemokine signaling pathway mlk04510   Focal adhesion mlk04520   Adherens junction mlk04611   Platelet activation mlk04670   Leukocyte transendothelial migration mlk04720   Long-term potentiation mlk04722   Neurotrophin signaling pathway mlk04934   Cushing syndrome mlk04972   Pancreatic secretion mlk05211   Renal cell carcinoma mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131839131 (RAP1B)    04014 Ras signaling pathway     131839131 (RAP1B)    04015 Rap1 signaling pathway     131839131 (RAP1B)    04024 cAMP signaling pathway     131839131 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     131839131 (RAP1B)    04520 Adherens junction     131839131 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     131839131 (RAP1B)    04670 Leukocyte transendothelial migration     131839131 (RAP1B)    04062 Chemokine signaling pathway     131839131 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     131839131 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     131839131 (RAP1B)    04722 Neurotrophin signaling pathway     131839131 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     131839131 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131839131 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     131839131 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131839131 (RAP1B)    04031 GTP-binding proteins [BR:mlk04031]     131839131 (RAP1B) Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131839131 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    131839131 (RAP1B)   Exosomal proteins of colorectal cancer cells    131839131 (RAP1B) GTP-binding proteins [BR:mlk04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     131839131 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  131839131 NCBI-ProteinID:  XP_059042251 LinkDB All DBs Position 8:103116517..103160258 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatacgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagatttatacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccgatgatcctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcagaacctagcaagacagtggaacaac tgtgcgttcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system