Methanococcus maripaludis KA1: MMKA1_07390 Help Entry MMKA1_07390       CDS       T03692                                  Symbol tpiA Name (GenBank) triosephosphate isomerase   KO K01803   triosephosphate isomerase (TIM) [EC:5.3.1.1] Organism mmak  Methanococcus maripaludis KA1 Pathway mmak00010   Glycolysis / Gluconeogenesis mmak00051   Fructose and mannose metabolism mmak00710   Carbon fixation by Calvin cycle mmak01100   Metabolic pathways mmak01110   Biosynthesis of secondary metabolites mmak01120   Microbial metabolism in diverse environments mmak01200   Carbon metabolism mmak01230   Biosynthesis of amino acids Module mmak_M00001   Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate mmak_M00002   Glycolysis, core module involving three-carbon compounds Brite KEGG Orthology (KO) [BR:mmak00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MMKA1_07390 (tpiA)    00051 Fructose and mannose metabolism     MMKA1_07390 (tpiA)    00562 Inositol phosphate metabolism     MMKA1_07390 (tpiA)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     MMKA1_07390 (tpiA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmak04147]     MMKA1_07390 (tpiA) Enzymes [BR:mmak01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.1  triose-phosphate isomerase      MMKA1_07390 (tpiA) Exosome [BR:mmak04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    MMKA1_07390 (tpiA)   Exosomal proteins of bladder cancer cells    MMKA1_07390 (tpiA)   Exosomal proteins of melanoma cells    MMKA1_07390 (tpiA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TIM ThiG FMN_dh His_biosynth IGPS NMO Hydrolase_like Motif Other DBs NCBI-ProteinID:  BAP60856 UniProt:  A0A2Z5PJG3 LinkDB All DBs Position 709122..709643 Genome browser AA seq 173 aa AA seqDB search MILDEVNIPVYAQHMDAVNPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEI SNKLGLKTVVCTNNIPVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVRE INKNVEILCGAGISKGEDVKSALELGTNGVLLASGVVKAKSVEDAIRELIAEI NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgattttagatgaagtaaatattcctgtttatgcacaacacatggatgcggtaaatcct ggaagcagtactggacacatactgcctgatgcattaaaagatgcaggagttactggaact cttttaaaccactctgaaagaagaatgcttcttgcagaccttgaaaaatgcattgaaatt tcaaataaacttggtttaaaaactgttgtatgtacaaacaatatacctgtttcaaaagca gtttctgcgttaaatccaacttcaattgcagtagaacctccagaattgattggaagcgga ataccagtttcaaaagcaaatcctgaagtagtatcaggaactgttagggaagttcgagaa attaacaaaaacgttgaaatattgtgcggtgcaggtatctcaaaaggggaagatgtaaaa tctgcgcttgaacttggaacaaacggtgttttgcttgcatcaggtgttgtaaaagctaaa agcgttgaagatgcaataagagaattaattgcagaaatttaa

DBGET integrated database retrieval system