Marmota marmota marmota (Alpine marmot): 107140230 Help Entry 107140230         CDS       T09644                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04010   MAPK signaling pathway mmma04014   Ras signaling pathway mmma04015   Rap1 signaling pathway mmma04024   cAMP signaling pathway mmma04062   Chemokine signaling pathway mmma04510   Focal adhesion mmma04520   Adherens junction mmma04611   Platelet activation mmma04670   Leukocyte transendothelial migration mmma04720   Long-term potentiation mmma04722   Neurotrophin signaling pathway mmma04934   Cushing syndrome mmma04972   Pancreatic secretion mmma05211   Renal cell carcinoma mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107140230    04014 Ras signaling pathway     107140230    04015 Rap1 signaling pathway     107140230    04024 cAMP signaling pathway     107140230  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     107140230    04520 Adherens junction     107140230  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     107140230    04670 Leukocyte transendothelial migration     107140230    04062 Chemokine signaling pathway     107140230   09154 Digestive system    04972 Pancreatic secretion     107140230   09156 Nervous system    04720 Long-term potentiation     107140230    04722 Neurotrophin signaling pathway     107140230  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     107140230   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107140230   09167 Endocrine and metabolic disease    04934 Cushing syndrome     107140230  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmma04147]     107140230    04031 GTP-binding proteins [BR:mmma04031]     107140230 Exosome [BR:mmma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107140230   Exosomal proteins of other body fluids (saliva and urine)    107140230   Exosomal proteins of colorectal cancer cells    107140230 GTP-binding proteins [BR:mmma04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     107140230 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  107140230 NCBI-ProteinID:  XP_048665730 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search YKLIVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVKVDAQQCLLEILDTAGTEQ FTAMRDLYMKNGQGFAMVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEYE RVVGKEQGQNLARQWNKCAFLESSAKSKINVNEIFYDLVQQINRKLQCLGRPAKSHSVSC FNILNAL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt tataagctaatcgttcttggctcaggaggggttggaaagtctgctctgactgtacaattt gttcaaggaatttttgttgaaaaatatgatcctacaatagaagattcttatagaaagcaa gttaaagtcgatgcacaacaatgtttgcttgaaatcctggatactgcaggaacagaacaa tttacagcaatgagggatttgtacatgaaaaatggacaaggctttgctatggtttattcc atcacagcacagtccacctttaatgatttacaagatttgagagaacagattcttcgagtt aaagacactgatgatgttcccatgattctggttggtaataagtgtgacttggaatatgaa agagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaagtgtgcattc ttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgacctagtgcag caaattaacagaaaactccagtgcctgggaaggcctgcaaaaagtcatagtgtcagctgc tttaatatactgaatgcattgtag

DBGET integrated database retrieval system