Marmota marmota marmota (Alpine marmot): 107146026 Help Entry 107146026         CDS       T09644                                  Symbol Il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma01521   EGFR tyrosine kinase inhibitor resistance mmma01523   Antifolate resistance mmma04060   Cytokine-cytokine receptor interaction mmma04061   Viral protein interaction with cytokine and cytokine receptor mmma04066   HIF-1 signaling pathway mmma04068   FoxO signaling pathway mmma04151   PI3K-Akt signaling pathway mmma04218   Cellular senescence mmma04620   Toll-like receptor signaling pathway mmma04621   NOD-like receptor signaling pathway mmma04623   Cytosolic DNA-sensing pathway mmma04625   C-type lectin receptor signaling pathway mmma04630   JAK-STAT signaling pathway mmma04640   Hematopoietic cell lineage mmma04657   IL-17 signaling pathway mmma04659   Th17 cell differentiation mmma04668   TNF signaling pathway mmma04672   Intestinal immune network for IgA production mmma04931   Insulin resistance mmma04932   Non-alcoholic fatty liver disease mmma04933   AGE-RAGE signaling pathway in diabetic complications mmma04936   Alcoholic liver disease mmma05010   Alzheimer disease mmma05020   Prion disease mmma05022   Pathways of neurodegeneration - multiple diseases mmma05132   Salmonella infection mmma05133   Pertussis mmma05134   Legionellosis mmma05135   Yersinia infection mmma05142   Chagas disease mmma05143   African trypanosomiasis mmma05144   Malaria mmma05146   Amoebiasis mmma05152   Tuberculosis mmma05161   Hepatitis B mmma05162   Measles mmma05163   Human cytomegalovirus infection mmma05164   Influenza A mmma05166   Human T-cell leukemia virus 1 infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05168   Herpes simplex virus 1 infection mmma05169   Epstein-Barr virus infection mmma05171   Coronavirus disease - COVID-19 mmma05200   Pathways in cancer mmma05202   Transcriptional misregulation in cancer mmma05321   Inflammatory bowel disease mmma05323   Rheumatoid arthritis mmma05332   Graft-versus-host disease mmma05410   Hypertrophic cardiomyopathy mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     107146026 (Il6)    04668 TNF signaling pathway     107146026 (Il6)    04066 HIF-1 signaling pathway     107146026 (Il6)    04068 FoxO signaling pathway     107146026 (Il6)    04151 PI3K-Akt signaling pathway     107146026 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107146026 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     107146026 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107146026 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     107146026 (Il6)    04620 Toll-like receptor signaling pathway     107146026 (Il6)    04621 NOD-like receptor signaling pathway     107146026 (Il6)    04623 Cytosolic DNA-sensing pathway     107146026 (Il6)    04625 C-type lectin receptor signaling pathway     107146026 (Il6)    04659 Th17 cell differentiation     107146026 (Il6)    04657 IL-17 signaling pathway     107146026 (Il6)    04672 Intestinal immune network for IgA production     107146026 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107146026 (Il6)    05202 Transcriptional misregulation in cancer     107146026 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107146026 (Il6)    05161 Hepatitis B     107146026 (Il6)    05171 Coronavirus disease - COVID-19     107146026 (Il6)    05164 Influenza A     107146026 (Il6)    05162 Measles     107146026 (Il6)    05168 Herpes simplex virus 1 infection     107146026 (Il6)    05163 Human cytomegalovirus infection     107146026 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     107146026 (Il6)    05169 Epstein-Barr virus infection     107146026 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     107146026 (Il6)    05135 Yersinia infection     107146026 (Il6)    05133 Pertussis     107146026 (Il6)    05134 Legionellosis     107146026 (Il6)    05152 Tuberculosis     107146026 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     107146026 (Il6)    05144 Malaria     107146026 (Il6)    05142 Chagas disease     107146026 (Il6)    05143 African trypanosomiasis     107146026 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     107146026 (Il6)    05321 Inflammatory bowel disease     107146026 (Il6)    05332 Graft-versus-host disease     107146026 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     107146026 (Il6)    05020 Prion disease     107146026 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     107146026 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107146026 (Il6)    05410 Hypertrophic cardiomyopathy     107146026 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     107146026 (Il6)    04932 Non-alcoholic fatty liver disease     107146026 (Il6)    04931 Insulin resistance     107146026 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     107146026 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     107146026 (Il6)    01523 Antifolate resistance     107146026 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmma04052]     107146026 (Il6) Cytokines and neuropeptides [BR:mmma04052]  Cytokines   Interleukins    107146026 (Il6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 DUF1137 Motif Other DBs NCBI-GeneID:  107146026 NCBI-ProteinID:  XP_048642284 UniProt:  A0A8C5YUY6 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MKFFSIASLGLLLVVATAFPASELQREDGENSVTRNKPTRASSGKTAGQISYLIKEVFEM RKELCKNDETCIKSHVAVSENNLNLPKMTEKDGCFQTGYNRDNCLVRITSGLLEFQVYLR YIRNKFQEGNNRDRAEHVQFSSKALIEILKQEVKDPNKIVFPSPTANINLLAKLESQNDW QKVMTMQLILSNFEDFLQFTLRAVRKA NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgaagttcttctcaattgcctccttggggctgctcctagtggtggctactgccttcccc gcctcagaacttcagagagaagatggagagaatagtgttactcgaaataaaccaacacgt gcctcttctggaaaaaccgcaggacagatttcctacctcatcaaggaagtcttcgaaatg agaaaagagctgtgcaagaatgatgagacctgtatcaagagccatgtggcagtgtccgaa aacaatctgaaccttccaaagatgactgaaaaagatggatgcttccaaactggatacaat cgggacaactgccttgtgcgaatcacctctgggcttctggagtttcaggtctacctgagg tacatccggaacaagtttcaggaaggcaataacagggacagagctgaacatgtgcagttc agttccaaagccctgattgagatcctgaaacaagaggtgaaggatcccaataaaatagtc ttccctagcccaactgcaaatatcaacctattggcaaaactggagtcacagaatgattgg cagaaggtcatgaccatgcaactcatcttgagcaactttgaggatttcctgcagttcacc ctgagagctgttcggaaagcatag

DBGET integrated database retrieval system