Marmota marmota marmota (Alpine marmot): 107149351 Help Entry 107149351         CDS       T09644                                  Symbol Fos Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma01522   Endocrine resistance mmma04010   MAPK signaling pathway mmma04024   cAMP signaling pathway mmma04210   Apoptosis mmma04380   Osteoclast differentiation mmma04620   Toll-like receptor signaling pathway mmma04657   IL-17 signaling pathway mmma04658   Th1 and Th2 cell differentiation mmma04659   Th17 cell differentiation mmma04660   T cell receptor signaling pathway mmma04662   B cell receptor signaling pathway mmma04668   TNF signaling pathway mmma04713   Circadian entrainment mmma04725   Cholinergic synapse mmma04728   Dopaminergic synapse mmma04915   Estrogen signaling pathway mmma04917   Prolactin signaling pathway mmma04921   Oxytocin signaling pathway mmma04926   Relaxin signaling pathway mmma04928   Parathyroid hormone synthesis, secretion and action mmma04932   Non-alcoholic fatty liver disease mmma04935   Growth hormone synthesis, secretion and action mmma05031   Amphetamine addiction mmma05132   Salmonella infection mmma05133   Pertussis mmma05135   Yersinia infection mmma05140   Leishmaniasis mmma05142   Chagas disease mmma05161   Hepatitis B mmma05162   Measles mmma05166   Human T-cell leukemia virus 1 infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05170   Human immunodeficiency virus 1 infection mmma05171   Coronavirus disease - COVID-19 mmma05200   Pathways in cancer mmma05207   Chemical carcinogenesis - receptor activation mmma05208   Chemical carcinogenesis - reactive oxygen species mmma05210   Colorectal cancer mmma05224   Breast cancer mmma05231   Choline metabolism in cancer mmma05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmma05323   Rheumatoid arthritis mmma05417   Lipid and atherosclerosis mmma05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107149351 (Fos)    04668 TNF signaling pathway     107149351 (Fos)    04024 cAMP signaling pathway     107149351 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     107149351 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107149351 (Fos)    04660 T cell receptor signaling pathway     107149351 (Fos)    04658 Th1 and Th2 cell differentiation     107149351 (Fos)    04659 Th17 cell differentiation     107149351 (Fos)    04657 IL-17 signaling pathway     107149351 (Fos)    04662 B cell receptor signaling pathway     107149351 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     107149351 (Fos)    04917 Prolactin signaling pathway     107149351 (Fos)    04921 Oxytocin signaling pathway     107149351 (Fos)    04926 Relaxin signaling pathway     107149351 (Fos)    04935 Growth hormone synthesis, secretion and action     107149351 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     107149351 (Fos)   09156 Nervous system    04725 Cholinergic synapse     107149351 (Fos)    04728 Dopaminergic synapse     107149351 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     107149351 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     107149351 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107149351 (Fos)    05207 Chemical carcinogenesis - receptor activation     107149351 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     107149351 (Fos)    05231 Choline metabolism in cancer     107149351 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     107149351 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     107149351 (Fos)    05224 Breast cancer     107149351 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107149351 (Fos)    05170 Human immunodeficiency virus 1 infection     107149351 (Fos)    05161 Hepatitis B     107149351 (Fos)    05171 Coronavirus disease - COVID-19     107149351 (Fos)    05162 Measles     107149351 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     107149351 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     107149351 (Fos)    05135 Yersinia infection     107149351 (Fos)    05133 Pertussis     107149351 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     107149351 (Fos)    05142 Chagas disease     107149351 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     107149351 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     107149351 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107149351 (Fos)    05418 Fluid shear stress and atherosclerosis     107149351 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     107149351 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     107149351 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmma03000]     107149351 (Fos)    04131 Membrane trafficking [BR:mmma04131]     107149351 (Fos) Transcription factors [BR:mmma03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     107149351 (Fos) Membrane trafficking [BR:mmma04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     107149351 (Fos) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 HALZ Macoilin Motif Other DBs NCBI-GeneID:  107149351 NCBI-ProteinID:  XP_015349642 Ensembl:  ENSMMMG00000018959 UniProt:  A0A8C5ZZ68 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLNVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQNRAPHPYGVPTPSTAAYSRTGAAKTMTGGRA QSMGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFA LPLLNDPEPKPSVEPIKSINSMELKAEPFDDFLFPASSRPSVSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctccggtcaatgcacaggacttctgcacggatctgaatgtctccagtgccaacttc atccccacagtgactgctatctcgaccagcccggacctgcagtggctggtgcaacccacc ttggtctcctccgtggccccatcgcagaacagagctccccacccctacggagtccccact ccctcgactgcggcttactccaggactggagcggcaaagaccatgacaggcggcagagcg cagagcatgggcaggaggggcaaggtagaacagttgtctcctgaagaagaagagaaaagg agaattcgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggagggag ctgactgataccctccaagcggagacagaccaacttgaagatgagaagtctgctttgcag actgagattgccaacctgttgaaggagaaggaaaaactggagttcatcctggcagctcac cgacctgcctgcaagatcccggatgacctgggcttcccagaagagatgtctgtggcatcc ctggatttgagtgggggcctgccagaggccgccaccccagaatctgaggaggcctttgca ttgcccctgctcaatgaccctgagcccaagccatcggtggagccgatcaagagcatcaac agcatggagctgaaggctgagcccttcgatgacttcctgttcccagcatcatccaggccc agcgtctctgagaccgctcgctcagtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcactacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaatgagccctcctctgactcactcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system