Marmota marmota marmota (Alpine marmot): 107155983 Help Entry 107155983         CDS       T09644                                  Symbol Actb Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma03082   ATP-dependent chromatin remodeling mmma04015   Rap1 signaling pathway mmma04145   Phagosome mmma04210   Apoptosis mmma04390   Hippo signaling pathway mmma04510   Focal adhesion mmma04517   IgSF CAM signaling mmma04520   Adherens junction mmma04530   Tight junction mmma04611   Platelet activation mmma04613   Neutrophil extracellular trap formation mmma04670   Leukocyte transendothelial migration mmma04714   Thermogenesis mmma04810   Regulation of actin cytoskeleton mmma04814   Motor proteins mmma04820   Cytoskeleton in muscle cells mmma04919   Thyroid hormone signaling pathway mmma04921   Oxytocin signaling pathway mmma04971   Gastric acid secretion mmma05014   Amyotrophic lateral sclerosis mmma05100   Bacterial invasion of epithelial cells mmma05132   Salmonella infection mmma05135   Yersinia infection mmma05164   Influenza A mmma05205   Proteoglycans in cancer mmma05225   Hepatocellular carcinoma mmma05410   Hypertrophic cardiomyopathy mmma05412   Arrhythmogenic right ventricular cardiomyopathy mmma05414   Dilated cardiomyopathy mmma05416   Viral myocarditis mmma05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107155983 (Actb)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     107155983 (Actb)    04390 Hippo signaling pathway     107155983 (Actb)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107155983 (Actb)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107155983 (Actb)   09143 Cell growth and death    04210 Apoptosis     107155983 (Actb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     107155983 (Actb)    04520 Adherens junction     107155983 (Actb)    04530 Tight junction     107155983 (Actb)   09142 Cell motility    04814 Motor proteins     107155983 (Actb)    04820 Cytoskeleton in muscle cells     107155983 (Actb)    04810 Regulation of actin cytoskeleton     107155983 (Actb)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     107155983 (Actb)    04613 Neutrophil extracellular trap formation     107155983 (Actb)    04670 Leukocyte transendothelial migration     107155983 (Actb)   09152 Endocrine system    04921 Oxytocin signaling pathway     107155983 (Actb)    04919 Thyroid hormone signaling pathway     107155983 (Actb)   09154 Digestive system    04971 Gastric acid secretion     107155983 (Actb)   09159 Environmental adaptation    04714 Thermogenesis     107155983 (Actb)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     107155983 (Actb)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     107155983 (Actb)   09172 Infectious disease: viral    05164 Influenza A     107155983 (Actb)   09171 Infectious disease: bacterial    05132 Salmonella infection     107155983 (Actb)    05135 Yersinia infection     107155983 (Actb)    05100 Bacterial invasion of epithelial cells     107155983 (Actb)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     107155983 (Actb)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     107155983 (Actb)    05410 Hypertrophic cardiomyopathy     107155983 (Actb)    05412 Arrhythmogenic right ventricular cardiomyopathy     107155983 (Actb)    05414 Dilated cardiomyopathy     107155983 (Actb)    05416 Viral myocarditis     107155983 (Actb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mmma03021]     107155983 (Actb)    03019 Messenger RNA biogenesis [BR:mmma03019]     107155983 (Actb)    03036 Chromosome and associated proteins [BR:mmma03036]     107155983 (Actb)    03029 Mitochondrial biogenesis [BR:mmma03029]     107155983 (Actb)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmma04812]     107155983 (Actb)    04147 Exosome [BR:mmma04147]     107155983 (Actb) Transcription machinery [BR:mmma03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      107155983 (Actb) Messenger RNA biogenesis [BR:mmma03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      107155983 (Actb) Chromosome and associated proteins [BR:mmma03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      107155983 (Actb)     NuA4 complex      107155983 (Actb)   Chromatin remodeling factors    BAF complex     107155983 (Actb)    PBAF complex     107155983 (Actb)    GBAF(ncBAF) complex     107155983 (Actb)    SWR1 complex     107155983 (Actb) Mitochondrial biogenesis [BR:mmma03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     107155983 (Actb) Cytoskeleton proteins [BR:mmma04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      107155983 (Actb) Exosome [BR:mmma04147]  Exosomal proteins   Proteins found in most exosomes    107155983 (Actb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  107155983 NCBI-ProteinID:  XP_015357507 Ensembl:  ENSMMMG00000007553 UniProt:  A0A8C5Z473 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatatcgctgcgctcgtcgttgacaacggctccggcatgtgcaaggccggc ttcgcgggcgacgatgctccccgggccgtcttcccctccatcgtggggcgcccgcggcac cagggtgtgatggtgggcatgggtcagaaggattcctatgtgggtgacgaggcccagagc aagagaggcatcctgaccctgaagtaccccattgagcatggcatcgtcaccaactgggac gacatggagaagatttggcaccacaccttctacaacgagctgcgtgtggctcctgaggag caccctgtgctgctgaccgaggctcccctgaaccctaaggccaaccgtgagaagatgacc cagatcatgtttgagaccttcaacaccccagccatgtatgtggccatccaggctgtgctg tccctgtatgcctctggccgtaccactggcattgtgatggactccggtgatggggtcacc cacacagtgcccatctacgaggggtatgcccttccccacgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgactgagcgtggctacagcttc accaccacagccgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctacgttgcc ctggacttcgagcaggagatggccactgcagcctctagctcctccctggagaagagctac gagctgcctgatggtcaggtgatcaccattggcaatgagcgattccgctgccctgaggca ctcttccagccttctttcctgggcatggaatcctgtggcatccatgaaactactttcaat tccatcatgaagtgtgacgttgacattcgcaaggacctctatgccaacacagtgctgtct ggtggcaccaccatgtacccaggcattgctgacaggatgcagaaggagatcacagccctg gcacccagcacaatgaagatcaagatcatcgctccccctgagcgcaagtactctgtgtgg attggcggctccatcctggcctctctgtccaccttccagcagatgtggatcagcaagcag gagtacgatgaatctggcccctccattgtccaccgtaaatgcttctag

DBGET integrated database retrieval system