Marmota marmota marmota (Alpine marmot): 107156489 Help Entry 107156489         CDS       T09644                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma04060   Cytokine-cytokine receptor interaction mmma04151   PI3K-Akt signaling pathway mmma04217   Necroptosis mmma04380   Osteoclast differentiation mmma04620   Toll-like receptor signaling pathway mmma04621   NOD-like receptor signaling pathway mmma04622   RIG-I-like receptor signaling pathway mmma04623   Cytosolic DNA-sensing pathway mmma04630   JAK-STAT signaling pathway mmma04650   Natural killer cell mediated cytotoxicity mmma04668   TNF signaling pathway mmma04936   Alcoholic liver disease mmma05135   Yersinia infection mmma05142   Chagas disease mmma05152   Tuberculosis mmma05160   Hepatitis C mmma05161   Hepatitis B mmma05162   Measles mmma05163   Human cytomegalovirus infection mmma05164   Influenza A mmma05165   Human papillomavirus infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05168   Herpes simplex virus 1 infection mmma05169   Epstein-Barr virus infection mmma05170   Human immunodeficiency virus 1 infection mmma05171   Coronavirus disease - COVID-19 mmma05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     107156489 (Ifnb1)    04668 TNF signaling pathway     107156489 (Ifnb1)    04151 PI3K-Akt signaling pathway     107156489 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107156489 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     107156489 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107156489 (Ifnb1)    04621 NOD-like receptor signaling pathway     107156489 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     107156489 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     107156489 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     107156489 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     107156489 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     107156489 (Ifnb1)    05161 Hepatitis B     107156489 (Ifnb1)    05160 Hepatitis C     107156489 (Ifnb1)    05171 Coronavirus disease - COVID-19     107156489 (Ifnb1)    05164 Influenza A     107156489 (Ifnb1)    05162 Measles     107156489 (Ifnb1)    05168 Herpes simplex virus 1 infection     107156489 (Ifnb1)    05163 Human cytomegalovirus infection     107156489 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     107156489 (Ifnb1)    05169 Epstein-Barr virus infection     107156489 (Ifnb1)    05165 Human papillomavirus infection     107156489 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     107156489 (Ifnb1)    05152 Tuberculosis     107156489 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     107156489 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107156489 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     107156489 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmma04052]     107156489 (Ifnb1) Cytokines and neuropeptides [BR:mmma04052]  Cytokines   Interferons    107156489 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF5477 Aip3p_Bud6_N Motif Other DBs NCBI-GeneID:  107156489 NCBI-ProteinID:  XP_015358049 Ensembl:  ENSMMMG00000006004 UniProt:  A0A8C5Z1P4 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MNNRCILQIVLLLCFPTTTLSLSYHLLRLQQSSSSLECQKLLQQLNGRPADCLSDRMDFK IPKEIKHPQQFQKEHAAFVIYEMLQDIFVIFTRNFSNTGWNETIVKDLRVELHQQMDLLE TTLEKKLGEENKSWGNSRTILHLKSYYWRILRYLKAKQYSSCAWTVIRMELFWNFSFINR LMDHFQN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaacaacaggtgcatcttgcaaatcgttctcctgttgtgcttccccaccacaactctt tccctaagttaccacctgcttagactccaacagagcagcagcagtttggaatgtcagaag ctcctgcagcagttgaatggaaggcctgcagactgcctcagtgacaggatggacttcaag atccccaaggagatcaaacatccacagcagttccagaaggagcacgctgcctttgtcatc tatgagatgctccaggacatctttgttattttcacaagaaacttctctaacactggctgg aatgagaccattgtcaaggacctccgtgttgaactccatcagcagatggacctcctggaa acaaccctggaaaagaaactgggagaggaaaacaaaagctggggaaactccaggaccatt ctgcacctgaaaagctattattggaggatcctgaggtacctgaaggccaaacagtacagc agctgtgcctggacagtgatccgaatggaactcttctggaacttctccttcattaacaga cttatggatcactttcaaaactga

DBGET integrated database retrieval system