Marmota marmota marmota (Alpine marmot): 107156942 Help Entry 107156942         CDS       T09644                                  Symbol Rela Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mmma  Marmota marmota marmota (Alpine marmot) Pathway mmma01523   Antifolate resistance mmma04010   MAPK signaling pathway mmma04014   Ras signaling pathway mmma04024   cAMP signaling pathway mmma04062   Chemokine signaling pathway mmma04064   NF-kappa B signaling pathway mmma04066   HIF-1 signaling pathway mmma04071   Sphingolipid signaling pathway mmma04137   Mitophagy - animal mmma04151   PI3K-Akt signaling pathway mmma04210   Apoptosis mmma04211   Longevity regulating pathway mmma04218   Cellular senescence mmma04380   Osteoclast differentiation mmma04613   Neutrophil extracellular trap formation mmma04620   Toll-like receptor signaling pathway mmma04621   NOD-like receptor signaling pathway mmma04622   RIG-I-like receptor signaling pathway mmma04623   Cytosolic DNA-sensing pathway mmma04625   C-type lectin receptor signaling pathway mmma04657   IL-17 signaling pathway mmma04658   Th1 and Th2 cell differentiation mmma04659   Th17 cell differentiation mmma04660   T cell receptor signaling pathway mmma04662   B cell receptor signaling pathway mmma04668   TNF signaling pathway mmma04722   Neurotrophin signaling pathway mmma04917   Prolactin signaling pathway mmma04920   Adipocytokine signaling pathway mmma04926   Relaxin signaling pathway mmma04931   Insulin resistance mmma04932   Non-alcoholic fatty liver disease mmma04933   AGE-RAGE signaling pathway in diabetic complications mmma04936   Alcoholic liver disease mmma05010   Alzheimer disease mmma05022   Pathways of neurodegeneration - multiple diseases mmma05030   Cocaine addiction mmma05132   Salmonella infection mmma05133   Pertussis mmma05134   Legionellosis mmma05135   Yersinia infection mmma05140   Leishmaniasis mmma05142   Chagas disease mmma05145   Toxoplasmosis mmma05146   Amoebiasis mmma05152   Tuberculosis mmma05160   Hepatitis C mmma05161   Hepatitis B mmma05162   Measles mmma05163   Human cytomegalovirus infection mmma05164   Influenza A mmma05165   Human papillomavirus infection mmma05166   Human T-cell leukemia virus 1 infection mmma05167   Kaposi sarcoma-associated herpesvirus infection mmma05168   Herpes simplex virus 1 infection mmma05169   Epstein-Barr virus infection mmma05170   Human immunodeficiency virus 1 infection mmma05171   Coronavirus disease - COVID-19 mmma05200   Pathways in cancer mmma05202   Transcriptional misregulation in cancer mmma05203   Viral carcinogenesis mmma05207   Chemical carcinogenesis - receptor activation mmma05208   Chemical carcinogenesis - reactive oxygen species mmma05212   Pancreatic cancer mmma05215   Prostate cancer mmma05220   Chronic myeloid leukemia mmma05221   Acute myeloid leukemia mmma05222   Small cell lung cancer mmma05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmma05321   Inflammatory bowel disease mmma05415   Diabetic cardiomyopathy mmma05417   Lipid and atherosclerosis mmma05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmma00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107156942 (Rela)    04014 Ras signaling pathway     107156942 (Rela)    04064 NF-kappa B signaling pathway     107156942 (Rela)    04668 TNF signaling pathway     107156942 (Rela)    04066 HIF-1 signaling pathway     107156942 (Rela)    04071 Sphingolipid signaling pathway     107156942 (Rela)    04024 cAMP signaling pathway     107156942 (Rela)    04151 PI3K-Akt signaling pathway     107156942 (Rela)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     107156942 (Rela)   09143 Cell growth and death    04210 Apoptosis     107156942 (Rela)    04218 Cellular senescence     107156942 (Rela)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107156942 (Rela)    04620 Toll-like receptor signaling pathway     107156942 (Rela)    04621 NOD-like receptor signaling pathway     107156942 (Rela)    04622 RIG-I-like receptor signaling pathway     107156942 (Rela)    04623 Cytosolic DNA-sensing pathway     107156942 (Rela)    04625 C-type lectin receptor signaling pathway     107156942 (Rela)    04660 T cell receptor signaling pathway     107156942 (Rela)    04658 Th1 and Th2 cell differentiation     107156942 (Rela)    04659 Th17 cell differentiation     107156942 (Rela)    04657 IL-17 signaling pathway     107156942 (Rela)    04662 B cell receptor signaling pathway     107156942 (Rela)    04062 Chemokine signaling pathway     107156942 (Rela)   09152 Endocrine system    04920 Adipocytokine signaling pathway     107156942 (Rela)    04917 Prolactin signaling pathway     107156942 (Rela)    04926 Relaxin signaling pathway     107156942 (Rela)   09156 Nervous system    04722 Neurotrophin signaling pathway     107156942 (Rela)   09158 Development and regeneration    04380 Osteoclast differentiation     107156942 (Rela)   09149 Aging    04211 Longevity regulating pathway     107156942 (Rela)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     107156942 (Rela)    05202 Transcriptional misregulation in cancer     107156942 (Rela)    05207 Chemical carcinogenesis - receptor activation     107156942 (Rela)    05208 Chemical carcinogenesis - reactive oxygen species     107156942 (Rela)    05203 Viral carcinogenesis     107156942 (Rela)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     107156942 (Rela)   09162 Cancer: specific types    05212 Pancreatic cancer     107156942 (Rela)    05221 Acute myeloid leukemia     107156942 (Rela)    05220 Chronic myeloid leukemia     107156942 (Rela)    05215 Prostate cancer     107156942 (Rela)    05222 Small cell lung cancer     107156942 (Rela)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     107156942 (Rela)    05170 Human immunodeficiency virus 1 infection     107156942 (Rela)    05161 Hepatitis B     107156942 (Rela)    05160 Hepatitis C     107156942 (Rela)    05171 Coronavirus disease - COVID-19     107156942 (Rela)    05164 Influenza A     107156942 (Rela)    05162 Measles     107156942 (Rela)    05168 Herpes simplex virus 1 infection     107156942 (Rela)    05163 Human cytomegalovirus infection     107156942 (Rela)    05167 Kaposi sarcoma-associated herpesvirus infection     107156942 (Rela)    05169 Epstein-Barr virus infection     107156942 (Rela)    05165 Human papillomavirus infection     107156942 (Rela)   09171 Infectious disease: bacterial    05132 Salmonella infection     107156942 (Rela)    05135 Yersinia infection     107156942 (Rela)    05133 Pertussis     107156942 (Rela)    05134 Legionellosis     107156942 (Rela)    05152 Tuberculosis     107156942 (Rela)   09174 Infectious disease: parasitic    05146 Amoebiasis     107156942 (Rela)    05145 Toxoplasmosis     107156942 (Rela)    05140 Leishmaniasis     107156942 (Rela)    05142 Chagas disease     107156942 (Rela)   09163 Immune disease    05321 Inflammatory bowel disease     107156942 (Rela)   09164 Neurodegenerative disease    05010 Alzheimer disease     107156942 (Rela)    05022 Pathways of neurodegeneration - multiple diseases     107156942 (Rela)   09165 Substance dependence    05030 Cocaine addiction     107156942 (Rela)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     107156942 (Rela)    05418 Fluid shear stress and atherosclerosis     107156942 (Rela)    05415 Diabetic cardiomyopathy     107156942 (Rela)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     107156942 (Rela)    04932 Non-alcoholic fatty liver disease     107156942 (Rela)    04931 Insulin resistance     107156942 (Rela)    04933 AGE-RAGE signaling pathway in diabetic complications     107156942 (Rela)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     107156942 (Rela)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmma03000]     107156942 (Rela) Transcription factors [BR:mmma03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     107156942 (Rela) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_dimer Motif Other DBs NCBI-GeneID:  107156942 NCBI-ProteinID:  XP_015358600 LinkDB All DBs Position Unknown AA seq 285 aa AA seqDB search MQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPR RIAVPSRSSTSISKSAPQPYTFTPSLSTINFDEFPPMMLPSGQISSQASALAPASAPVLA QALVPAPSMPPPLAQAQAQAPAPGPVLAPGPPQAVAPPASKTTQAGESTLSEALLHLQFD ADEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGVSMPHPTAEPMLMEYPEAITRLVT GSQRPPDPAPTSLGNSGLPNGLTGDEDFSSIVDMDFSALLSQISS NT seq 858 nt NT seq  +upstreamnt  +downstreamnt atgcagctgcgacggccttctgaccgggagctcagtgagcccatggagttccagtacctg ccagacacagatgatcgtcatcgtattgaggagaaacgcaaaaggacatatgagacattc aagagcatcatgaagaagagtcctttcagtggacccactgatccccggcctccaccccgg cgtattgccgtgccttcccgcagctcaacttccatctctaagtcagccccccagccctac acctttacaccatccctcagcaccatcaacttcgatgagtttccccccatgatgttacct tctgggcagatctcaagccaggcctctgccttggcaccagcctctgccccagtcttggcc caggccttggtcccagccccatccatgccaccacctctggcccaggcccaggcccaggcc ccagcccctggcccagtcctagccccaggccctccccaggctgtggccccacctgcctca aagaccacccaggccggggaaagcacactgtcggaggccctgctacacttacaattcgat gctgatgaagatctgggggccctgcttggcaacagcacagacccagccgtattcacagac ctggcctcagtcgacaactcggagtttcagcagctgctgaaccagggtgtatccatgccc caccccacagctgagcctatgctaatggagtaccctgaggccatcactcgcctggtgaca ggttcccagaggccccctgacccagctcccacctccctgggaaactccgggctccccaat ggcctcacaggggatgaagacttctcctccattgtggacatggacttctcagcccttctg agtcagatcagctcctaa

DBGET integrated database retrieval system