Mus musculus (house mouse): 12500 Help Entry 12500             CDS       T01002                                  Symbol Cd3d, T3d Name (RefSeq) CD3 antigen, delta polypeptide   KO K06450   T-cell surface glycoprotein CD3 delta chain Organism mmu  Mus musculus (house mouse) Pathway mmu04640   Hematopoietic cell lineage mmu04658   Th1 and Th2 cell differentiation mmu04659   Th17 cell differentiation mmu04660   T cell receptor signaling pathway mmu05142   Chagas disease mmu05162   Measles mmu05166   Human T-cell leukemia virus 1 infection mmu05169   Epstein-Barr virus infection mmu05170   Human immunodeficiency virus 1 infection mmu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmu05340   Primary immunodeficiency Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     12500 (Cd3d)    04660 T cell receptor signaling pathway     12500 (Cd3d)    04658 Th1 and Th2 cell differentiation     12500 (Cd3d)    04659 Th17 cell differentiation     12500 (Cd3d)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     12500 (Cd3d)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     12500 (Cd3d)    05170 Human immunodeficiency virus 1 infection     12500 (Cd3d)    05162 Measles     12500 (Cd3d)    05169 Epstein-Barr virus infection     12500 (Cd3d)   09174 Infectious disease: parasitic    05142 Chagas disease     12500 (Cd3d)   09163 Immune disease    05340 Primary immunodeficiency     12500 (Cd3d)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:mmu04090]     12500 (Cd3d) CD molecules [BR:mmu04090]  Proteins   12500 (Cd3d) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ig_4 ITAM Ig_5 Motif Other DBs NCBI-GeneID:  12500 NCBI-ProteinID:  NP_038515 MGI:  88331 Ensembl:  ENSMUSG00000032094 UniProt:  P04235 Q3U4T1 Q3V3B4 Q6P5P1 LinkDB All DBs Position 9:44893067..44898350 Genome browser AA seq 173 aa AA seqDB search MEHSGILASLILIAVLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNL GKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLAL GVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggaacacagcgggattctggctagtctgatactgattgctgttctcccccaagggagc cccttcaagatacaagtgaccgaatatgaggacaaagtatttgtgacctgcaataccagc gtcatgcatctagatggaacggtggaaggatggtttgcaaagaataaaacactcaacttg ggcaaaggcgttctggacccacgagggatatatctgtgtaatgggacagagcagctggca aaggtggtgtcttctgtgcaagtccattaccgaatgtgccagaactgtgtggagctagac tcgggcaccatggctggtgtcatcttcattgacctcatcgcaactctgctcctggctttg ggcgtctactgctttgcaggacatgagaccggaaggccttctggggctgctgaggttcaa gcactgctgaagaatgagcagctgtatcagcctcttcgagatcgtgaagatacccagtac agccgtcttggagggaactggccccggaacaagaaatcttaa

DBGET integrated database retrieval system