KEGG   Mus musculus (house mouse): 12649
Entry
12649             CDS       T01002                                 
Symbol
Chek1, C85740, Chk1, rad27
Name
(RefSeq) checkpoint kinase 1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu05166  Human T-cell leukemia virus 1 infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12649 (Chek1)
   04115 p53 signaling pathway
    12649 (Chek1)
   04218 Cellular senescence
    12649 (Chek1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12649 (Chek1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12649 (Chek1)
   05170 Human immunodeficiency virus 1 infection
    12649 (Chek1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12649 (Chek1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12649 (Chek1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12649 (Chek1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   12649 (Chek1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12649 (Chek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 12649
NCBI-ProteinID: NP_031717
MGI: 1202065
Ensembl: ENSMUSG00000032113
UniProt: O35280
LinkDB
Position
9:complement(36619778..36637954)
AA seq 476 aa
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRITEEAVAVKIVDMKRAIDCPENIKKEICINK
MLSHENVVKFYGHRREGHIQYLFLEYCSGGELFDRIEPDIGMPEQDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNNRERLLNKMCGTLPYVAPELLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVETPSARITIPDIKKDRWYNKPLNRGAKRPRATSGGMSESSSGFSKHIHSNLDF
SPVNNGSSEETVKFSSSQPEPRTGLSLWDTGPSNVDKLVQGISFSQPTCPEHMLVNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETFEKLGYQWKKSCMNQVTVSTTDRR
NNKLIFKINLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSDVVSSQKVWFPVT
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcagtgccttttgtggaagactgggatttggtgcaaactttgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagaataactgaagaagctgttgcagtgaaaattgta
gacatgaagcgggccatagactgtccagaaaatattaagaaagagatctgcatcaataaa
atgttaagccacgagaatgtagtgaaattctatggccacaggagggaaggccatatccag
tatctgtttctggagtactgtagtggaggagaactttttgatagaattgagccagacata
gggatgcctgaacaagatgctcagaggttcttccaccaactcatggcaggggtggtttat
cttcatggaattggaataactcacagggatattaaaccagaaaacctcctcttggatgaa
agggataacctcaaaatctctgactttggcttggcaacggtatttcggcataataatcgt
gaacgcttactgaacaagatgtgtgggactttaccttatgttgctccggagcttctaaag
agaaaagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgttggctggagaattgccgtgggaccagcccagtgatagctgtcaggaatattctgat
tggaaagaaaaaaaaacctatctcaatccttggaaaaaaattgattctgctcctctggct
ttgcttcataaaattctagttgagactccatcagcaaggatcaccatcccagacattaag
aaagatagatggtacaacaaaccacttaacagaggagcaaagaggccacgcgccacatca
ggtggtatgtcagagtcttctagtggattctctaagcacattcattccaatttggacttt
tctccagtaaataatggttccagtgaagaaaccgtgaagttctctagttcccagccagag
ccgagaacagggctttccttgtgggacactggtccctcgaacgtggacaaactggttcag
ggcatcagtttttcccagcctacgtgtcctgagcatatgcttgtaaacagtcagttactc
ggtacccctggatcttcacagaacccctggcagcgcttggtcaaaaggatgacacgattc
tttactaaattggatgcggacaaatcttaccaatgcctgaaagagaccttcgagaagttg
ggctatcagtggaagaagagttgtatgaatcaggttactgtatcaacaactgatagaaga
aacaataagttgattttcaaaataaatttggtagaaatggatgagaagatactggttgac
ttccgactttctaagggtgatggattagagttcaagagacacttcctgaagattaaaggg
aagctcagcgatgttgtgagcagccagaaggtttggtttcctgttacatga

DBGET integrated database retrieval system