KEGG   Mus musculus (mouse): 13038Help
Entry
13038             CDS       T01002                                 

Gene name
Ctsk, AI323530, MMS10-Q, Ms10q, catK
Definition
(RefSeq) cathepsin K
  KO
K01371  cathepsin K [EC:3.4.22.38]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    13038 (Ctsk)
  09143 Cell growth and death
   04210 Apoptosis
    13038 (Ctsk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    13038 (Ctsk)
  09158 Development
   04380 Osteoclast differentiation
    13038 (Ctsk)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    13038 (Ctsk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    13038 (Ctsk)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    13038 (Ctsk)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     13038 (Ctsk)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C1: papain family
   13038 (Ctsk)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Papain family
   13038 (Ctsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 13038
NCBI-ProteinID: NP_031828
MGI: 107823
Ensembl: ENSMUSG00000028111
Vega: OTTMUSG00000053004
UniProt: P55097 Q545T0
LinkDB All DBs
Structure
PDB: 

Position
3 F2.1; 3 40.74 cM
AA seq 329 aa AA seqDB search
MWVFKFLLLPMVSFALSPEEMLDTQWELWKKTHQKQYNSKVDEISRRLIWEKNLKQISAH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLRIPPSRSYSNDTLYTPEWEGRVPDSID
YRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGG
YMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVA
RVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGE
SWGNKGYALLARNKNNACGITNMASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtgttcaagtttctgctgctacccatggtgagctttgctctgtctccggaggaa
atgctggacacccagtgggagctatggaagaagactcaccagaagcagtataacagcaag
gtggatgaaatctctcggcgtttaatttgggagaaaaacctgaagcaaatctctgcccat
aacctggaggcctctcttggtgtccatacatatgaactggccatgaaccacttgggagac
atgaccagtgaagaagtggttcagaagatgacgggactcagaatacctccctctcgatcc
tacagtaatgacactctctataccccagagtgggaaggcagggtcccagactccatcgac
tatcgaaagaaaggatacgttactccagtcaagaaccagggccagtgtggttcctgttgg
gctttcagctctgccggggccctggagggccaactcaagaagaaaactggtaaactctta
gctctgagtccccagaatcttgtggactgtgtgactgagaattatggctgtggaggcggc
tatatgaccactgccttccaatacgtgcagcagaacggaggcattgactctgaagatgct
tacccatatgtgggccaggatgaaagttgtatgtataacgccacggcaaaggcagctaaa
tgcagagggtacagagagattcctgtggggaacgagaaagccctgaagagagcagtggcg
cgggtaggacccatctctgtgtccatcgatgcaagcttggcatctttccagttttacagc
agaggtgtgtactatgatgaaaattgtgaccgtgataatgtgaaccatgcagtgttggtg
gtgggctatggcacccagaagggaagcaagcactggataattaaaaacagctggggagag
agctggggaaacaaaggatatgctctcttggctcggaataagaacaacgcctgcggcatt
accaacatggccagcttccccaagatgtga

DBGET integrated database retrieval system