KEGG   Mus musculus (house mouse): 14131
Entry
14131             CDS       T01002                                 
Symbol
Fcgr3, CD16
Name
(RefSeq) Fc receptor, IgG, low affinity III
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04145  Phagosome
mmu04380  Osteoclast differentiation
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04666  Fc gamma R-mediated phagocytosis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14131 (Fcgr3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14131 (Fcgr3)
   04613 Neutrophil extracellular trap formation
    14131 (Fcgr3)
   04666 Fc gamma R-mediated phagocytosis
    14131 (Fcgr3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14131 (Fcgr3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    14131 (Fcgr3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    14131 (Fcgr3)
   05150 Staphylococcus aureus infection
    14131 (Fcgr3)
   05152 Tuberculosis
    14131 (Fcgr3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14131 (Fcgr3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    14131 (Fcgr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14131 (Fcgr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14131 (Fcgr3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    14131 (Fcgr3)
CD molecules [BR:mmu04090]
 Proteins
  14131 (Fcgr3)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 Ig_5 I-set Lipocalin_5 TadE
Other DBs
NCBI-GeneID: 14131
NCBI-ProteinID: NP_001343440
MGI: 95500
Ensembl: ENSMUSG00000059498
LinkDB
Position
1:complement(170878738..170893476)
AA seq 266 aa
MTLDTQMFQNAHSGSQWLLPPLTILLLFAFADRQSALPKAVVKLDPPWIQVLKEDMVTLM
CEGTHNPGNSSTQWFHNWSSIRSQVQSSYTFKATVNDSGEYRCQMEQTRLSDPVDLGVIS
DWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSH
SGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYV
RRNLQTPRDYWRKSLSIRKHQAPQDK
NT seq 801 nt   +upstreamnt  +downstreamnt
atgactttggacacccagatgtttcagaatgcacactctggaagccaatggctacttcca
ccactgacaattctgctgctgtttgcttttgcagacaggcagagtgctcttccgaaggct
gtggtgaaactggaccccccatggatccaggtgctcaaggaagacatggtgacactgatg
tgcgaagggacccacaaccctgggaactcttctactcagtggttccacaactggagttcc
atccggagccaggtccaatccagctacacgtttaaggccacagtcaatgacagtggagaa
tatcggtgtcaaatggagcagacccgcctcagcgaccctgtagatctgggagtgatttct
gactggctgctgctccagacccctcagcgggtgtttctggaaggggaaaccatcacgcta
aggtgccatagctggaggaacaaactactgaacaggatctcgttcttccataatgaaaaa
tccgtgaggtatcatcactacaaaagtaatttctctatcccaaaagccaaccacagtcac
agtggggactactactgcaaaggaagtctaggaagtacacagcaccagtccaagcctgtc
accatcactgtccaagacccagcaactacatcctccatctctctagtctggtaccacact
gctttctccctagtgatgtgcctcctgtttgcagtggacacgggcctttatttctatgta
cggagaaatcttcaaaccccgagggattactggaggaagtccctgtcaatcagaaagcac
caggctcctcaagacaagtga

DBGET integrated database retrieval system