Mus musculus (house mouse): 14281 Help Entry 14281             CDS       T01002                                  Symbol Fos, D12Rfj1, c-fos, cFos Name (RefSeq) FBJ osteosarcoma oncogene   KO K04379   proto-oncogene protein c-fos Organism mmu  Mus musculus (house mouse) Pathway mmu01522   Endocrine resistance mmu04010   MAPK signaling pathway mmu04024   cAMP signaling pathway mmu04210   Apoptosis mmu04380   Osteoclast differentiation mmu04620   Toll-like receptor signaling pathway mmu04657   IL-17 signaling pathway mmu04658   Th1 and Th2 cell differentiation mmu04659   Th17 cell differentiation mmu04660   T cell receptor signaling pathway mmu04662   B cell receptor signaling pathway mmu04668   TNF signaling pathway mmu04713   Circadian entrainment mmu04725   Cholinergic synapse mmu04728   Dopaminergic synapse mmu04915   Estrogen signaling pathway mmu04917   Prolactin signaling pathway mmu04921   Oxytocin signaling pathway mmu04926   Relaxin signaling pathway mmu04928   Parathyroid hormone synthesis, secretion and action mmu04932   Non-alcoholic fatty liver disease mmu04935   Growth hormone synthesis, secretion and action mmu05031   Amphetamine addiction mmu05132   Salmonella infection mmu05133   Pertussis mmu05135   Yersinia infection mmu05140   Leishmaniasis mmu05142   Chagas disease mmu05161   Hepatitis B mmu05162   Measles mmu05166   Human T-cell leukemia virus 1 infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05171   Coronavirus disease - COVID-19 mmu05200   Pathways in cancer mmu05207   Chemical carcinogenesis - receptor activation mmu05208   Chemical carcinogenesis - reactive oxygen species mmu05210   Colorectal cancer mmu05224   Breast cancer mmu05231   Choline metabolism in cancer mmu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmu05323   Rheumatoid arthritis mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     14281 (Fos)    04668 TNF signaling pathway     14281 (Fos)    04024 cAMP signaling pathway     14281 (Fos)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     14281 (Fos)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     14281 (Fos)    04660 T cell receptor signaling pathway     14281 (Fos)    04658 Th1 and Th2 cell differentiation     14281 (Fos)    04659 Th17 cell differentiation     14281 (Fos)    04657 IL-17 signaling pathway     14281 (Fos)    04662 B cell receptor signaling pathway     14281 (Fos)   09152 Endocrine system    04915 Estrogen signaling pathway     14281 (Fos)    04917 Prolactin signaling pathway     14281 (Fos)    04921 Oxytocin signaling pathway     14281 (Fos)    04926 Relaxin signaling pathway     14281 (Fos)    04935 Growth hormone synthesis, secretion and action     14281 (Fos)    04928 Parathyroid hormone synthesis, secretion and action     14281 (Fos)   09156 Nervous system    04725 Cholinergic synapse     14281 (Fos)    04728 Dopaminergic synapse     14281 (Fos)   09158 Development and regeneration    04380 Osteoclast differentiation     14281 (Fos)   09159 Environmental adaptation    04713 Circadian entrainment     14281 (Fos)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     14281 (Fos)    05207 Chemical carcinogenesis - receptor activation     14281 (Fos)    05208 Chemical carcinogenesis - reactive oxygen species     14281 (Fos)    05231 Choline metabolism in cancer     14281 (Fos)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     14281 (Fos)   09162 Cancer: specific types    05210 Colorectal cancer     14281 (Fos)    05224 Breast cancer     14281 (Fos)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     14281 (Fos)    05170 Human immunodeficiency virus 1 infection     14281 (Fos)    05161 Hepatitis B     14281 (Fos)    05171 Coronavirus disease - COVID-19     14281 (Fos)    05162 Measles     14281 (Fos)    05167 Kaposi sarcoma-associated herpesvirus infection     14281 (Fos)   09171 Infectious disease: bacterial    05132 Salmonella infection     14281 (Fos)    05135 Yersinia infection     14281 (Fos)    05133 Pertussis     14281 (Fos)   09174 Infectious disease: parasitic    05140 Leishmaniasis     14281 (Fos)    05142 Chagas disease     14281 (Fos)   09163 Immune disease    05323 Rheumatoid arthritis     14281 (Fos)   09165 Substance dependence    05031 Amphetamine addiction     14281 (Fos)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     14281 (Fos)    05418 Fluid shear stress and atherosclerosis     14281 (Fos)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     14281 (Fos)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     14281 (Fos)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmu03000]     14281 (Fos)    04131 Membrane trafficking [BR:mmu04131]     14281 (Fos) Transcription factors [BR:mmu03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     14281 (Fos) Membrane trafficking [BR:mmu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     14281 (Fos) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  14281 NCBI-ProteinID:  NP_034364 MGI:  95574 Ensembl:  ENSMUSG00000021250 UniProt:  P01101 Structure PDB LinkDB All DBs Position 12:85520664..85524048 Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFT LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYA ADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggtttcaacgccgactacgaggcgtcatcctcccgctgcagtagcgcc tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg ggctctcctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc cagtctgctggggcttacgccagagcgggaatggtgaagaccgtgtcaggaggcagagcg cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg agaatccgaagggaacggaataagatggctgcagccaagtgccggaatcggaggagggag ctgacagatacactccaagcggagacagatcaacttgaagatgagaagtctgcgttgcag actgagattgccaatctgctgaaagagaaggaaaaactggagtttattttggcagcccac cgacctgcctgcaagatccccgatgaccttggcttcccagaggagatgtctgtggcctcc ctggatttgactggaggtctgcctgaggcttccaccccagagtctgaggaggccttcacc ctgccccttctcaacgaccctgagcccaagccatccttggagccagtcaagagcatcagc aacgtggagctgaaggcagaaccctttgatgacttcttgtttccggcatcatctaggccc agtggctcagagacctcccgctctgtgccagatgtggacctgtccggttccttctatgca gcagactgggagcctctgcacagcaattccttggggatggggcccatggtcacagagctg gagcccctgtgtactcccgtggtcacctgtactccgggctgcactacttacacgtcttcc tttgtcttcacctaccctgaagctgactccttcccaagctgtgccgctgcccaccgaaag ggcagcagcagcaacgagccctcctccgactccctgagctcacccacgctgctggccctg tga

Mus musculus (house mouse): 16476 Help Entry 16476             CDS       T01002                                  Symbol Jun, AP-1, Junc, c-jun Name (RefSeq) jun proto-oncogene   KO K04448   transcription factor AP-1 Organism mmu  Mus musculus (house mouse) Pathway mmu01522   Endocrine resistance mmu04010   MAPK signaling pathway mmu04012   ErbB signaling pathway mmu04024   cAMP signaling pathway mmu04137   Mitophagy - animal mmu04210   Apoptosis mmu04310   Wnt signaling pathway mmu04380   Osteoclast differentiation mmu04510   Focal adhesion mmu04530   Tight junction mmu04620   Toll-like receptor signaling pathway mmu04621   NOD-like receptor signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04657   IL-17 signaling pathway mmu04658   Th1 and Th2 cell differentiation mmu04659   Th17 cell differentiation mmu04660   T cell receptor signaling pathway mmu04662   B cell receptor signaling pathway mmu04668   TNF signaling pathway mmu04722   Neurotrophin signaling pathway mmu04912   GnRH signaling pathway mmu04915   Estrogen signaling pathway mmu04921   Oxytocin signaling pathway mmu04926   Relaxin signaling pathway mmu04932   Non-alcoholic fatty liver disease mmu04933   AGE-RAGE signaling pathway in diabetic complications mmu05030   Cocaine addiction mmu05031   Amphetamine addiction mmu05132   Salmonella infection mmu05133   Pertussis mmu05135   Yersinia infection mmu05140   Leishmaniasis mmu05142   Chagas disease mmu05161   Hepatitis B mmu05162   Measles mmu05166   Human T-cell leukemia virus 1 infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05169   Epstein-Barr virus infection mmu05170   Human immunodeficiency virus 1 infection mmu05171   Coronavirus disease - COVID-19 mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05207   Chemical carcinogenesis - receptor activation mmu05208   Chemical carcinogenesis - reactive oxygen species mmu05210   Colorectal cancer mmu05211   Renal cell carcinoma mmu05224   Breast cancer mmu05231   Choline metabolism in cancer mmu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmu05321   Inflammatory bowel disease mmu05323   Rheumatoid arthritis mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     16476 (Jun)    04012 ErbB signaling pathway     16476 (Jun)    04310 Wnt signaling pathway     16476 (Jun)    04668 TNF signaling pathway     16476 (Jun)    04024 cAMP signaling pathway     16476 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     16476 (Jun)   09143 Cell growth and death    04210 Apoptosis     16476 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     16476 (Jun)    04530 Tight junction     16476 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     16476 (Jun)    04621 NOD-like receptor signaling pathway     16476 (Jun)    04625 C-type lectin receptor signaling pathway     16476 (Jun)    04660 T cell receptor signaling pathway     16476 (Jun)    04658 Th1 and Th2 cell differentiation     16476 (Jun)    04659 Th17 cell differentiation     16476 (Jun)    04657 IL-17 signaling pathway     16476 (Jun)    04662 B cell receptor signaling pathway     16476 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     16476 (Jun)    04915 Estrogen signaling pathway     16476 (Jun)    04921 Oxytocin signaling pathway     16476 (Jun)    04926 Relaxin signaling pathway     16476 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     16476 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     16476 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16476 (Jun)    05207 Chemical carcinogenesis - receptor activation     16476 (Jun)    05208 Chemical carcinogenesis - reactive oxygen species     16476 (Jun)    05203 Viral carcinogenesis     16476 (Jun)    05231 Choline metabolism in cancer     16476 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     16476 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     16476 (Jun)    05211 Renal cell carcinoma     16476 (Jun)    05224 Breast cancer     16476 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     16476 (Jun)    05170 Human immunodeficiency virus 1 infection     16476 (Jun)    05161 Hepatitis B     16476 (Jun)    05171 Coronavirus disease - COVID-19     16476 (Jun)    05162 Measles     16476 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     16476 (Jun)    05169 Epstein-Barr virus infection     16476 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     16476 (Jun)    05135 Yersinia infection     16476 (Jun)    05133 Pertussis     16476 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     16476 (Jun)    05142 Chagas disease     16476 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     16476 (Jun)    05321 Inflammatory bowel disease     16476 (Jun)   09165 Substance dependence    05030 Cocaine addiction     16476 (Jun)    05031 Amphetamine addiction     16476 (Jun)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     16476 (Jun)    05418 Fluid shear stress and atherosclerosis     16476 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     16476 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     16476 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     16476 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmu03000]     16476 (Jun) Transcription factors [BR:mmu03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     16476 (Jun) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha DUF3450 TFIIA FlaC_arch NYD-SP28_assoc Motif Other DBs NCBI-GeneID:  16476 NCBI-ProteinID:  NP_034721 MGI:  96646 Ensembl:  ENSMUSG00000052684 UniProt:  P05627 Q52L79 LinkDB All DBs Position 4:complement(94937273..94940459) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccctaagatcctaaaacagagcatgaccttg aacctggccgacccggtgggcagtctgaagccgcacctccgcgccaagaactcggacctt ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgccggagctggagcgcctgatc atccagtccagcaatgggcacatcaccactacaccgacccccacccagttcttgtgcccc aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa ctgcatagccagaacacgcttcccagtgtcacctccgcggcacagccggtcagcggggcg ggcatggtggctcccgcggtggcctcagtagcaggcgctggcggcggtggtggctacagc gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg ctgagcagcggcggtggggcgccctcctatggcgcggccgggctggcctttccctcgcag ccgcagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg cagcacccgcggctgcaagccctgaaggaagagccgcagaccgtgccggagatgccggga gagacgccgcccctgtcccctatcgacatggagtctcaggagcggatcaaggcagagagg aagcgcatgaggaaccgcattgccgcctccaagtgccggaaaaggaagctggagcggatc gctcggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcatccacg gccaacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system