KEGG   Mus musculus (house mouse): 14825
Entry
14825             CDS       T01002                                 
Symbol
Cxcl1, Fsp, Gro1, KC, Mgsa, N51, Scyb1, gro
Name
(RefSeq) chemokine (C-X-C motif) ligand 1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    14825 (Cxcl1)
   04668 TNF signaling pathway
    14825 (Cxcl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14825 (Cxcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    14825 (Cxcl1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    14825 (Cxcl1)
   04657 IL-17 signaling pathway
    14825 (Cxcl1)
   04062 Chemokine signaling pathway
    14825 (Cxcl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    14825 (Cxcl1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    14825 (Cxcl1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14825 (Cxcl1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    14825 (Cxcl1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    14825 (Cxcl1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    14825 (Cxcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14825 (Cxcl1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   14825 (Cxcl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 14825
NCBI-ProteinID: NP_032202
MGI: 108068
Ensembl: ENSMUSG00000029380
UniProt: P12850 A2RTH0
LinkDB
Position
5:91039104..91040980
AA seq 96 aa
MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCT
QTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
NT seq 291 nt   +upstreamnt  +downstreamnt
atgatcccagccacccgctcgcttctctgtgcagcgctgctgctgctggccaccagccgc
ctggccacaggggcgcctatcgccaatgagctgcgctgtcagtgcctgcagaccatggct
gggattcacctcaagaacatccagagcttgaaggtgttgccctcagggccccactgcacc
caaaccgaagtcatagccacactcaagaatggtcgcgaggcttgccttgaccctgaagct
cccttggttcagaaaattgtccaaaagatgctaaaaggtgtccccaagtaa

KEGG   Mus musculus (house mouse): 20310
Entry
20310             CDS       T01002                                 
Symbol
Cxcl2, CINC-2a, GROb, Gro2, MIP-2, MIP-2a, Mgsa-b, Mip2, Scyb, Scyb2
Name
(RefSeq) chemokine (C-X-C motif) ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    20310 (Cxcl2)
   04668 TNF signaling pathway
    20310 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20310 (Cxcl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20310 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20310 (Cxcl2)
   04657 IL-17 signaling pathway
    20310 (Cxcl2)
   04062 Chemokine signaling pathway
    20310 (Cxcl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    20310 (Cxcl2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    20310 (Cxcl2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    20310 (Cxcl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20310 (Cxcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    20310 (Cxcl2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    20310 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20310 (Cxcl2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20310 (Cxcl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 20310
NCBI-ProteinID: NP_033166
MGI: 1340094
Ensembl: ENSMUSG00000058427
UniProt: P10889 Q3U1J5
Structure
LinkDB
Position
5:91051758..91053797
AA seq 100 aa
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGP
HCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacctgccggctcctcagtgctgcactggtcctgctgctgctgctggcc
accaaccaccaggctacaggggctgttgtggccagtgaactgcgctgtcaatgcctgaag
accctgccaagggttgacttcaagaacatccagagcttgagtgtgacgcccccaggaccc
cactgcgcccagacagaagtcatagccactctcaagggcggtcaaaaagtttgccttgac
cctgaagcccccctggttcagaaaatcatccaaaagatactgaacaaaggcaaggctaac
tga

KEGG   Mus musculus (house mouse): 330122
Entry
330122            CDS       T01002                                 
Symbol
Cxcl3, Dcip1, Gm1960
Name
(RefSeq) chemokine (C-X-C motif) ligand 3
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05134  Legionellosis
mmu05146  Amoebiasis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    330122 (Cxcl3)
   04668 TNF signaling pathway
    330122 (Cxcl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    330122 (Cxcl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    330122 (Cxcl3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    330122 (Cxcl3)
   04657 IL-17 signaling pathway
    330122 (Cxcl3)
   04062 Chemokine signaling pathway
    330122 (Cxcl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    330122 (Cxcl3)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    330122 (Cxcl3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    330122 (Cxcl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    330122 (Cxcl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    330122 (Cxcl3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    330122 (Cxcl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    330122 (Cxcl3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   330122 (Cxcl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 330122
NCBI-ProteinID: NP_976065
MGI: 3037818
Ensembl: ENSMUSG00000029379
UniProt: Q6W5C0
LinkDB
Position
5:90933960..90935952
AA seq 100 aa
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGP
HCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacctgccggctcctcagtgctgcactggtcctgctgctgctgctggcc
accaaccaccaggctacaggggctgttgtggccagtgagctgcgctgtcagtgcctgaac
accctaccaagggttgattttgagaccatccagagcttgacggtgacgcccccaggaccc
cactgcacccagacagaagtcatagccactctcaaggatggtcaagaagtttgcctcaac
ccccaaggccccaggcttcagataatcatcaagaagatactgaagagcggcaagtccagc
tga

DBGET integrated database retrieval system