KEGG   Mus musculus (house mouse): 15977
Entry
15977             CDS       T01002                                 
Symbol
Ifnb1, IFN-beta, IFNB, If1da1, Ifb
Name
(RefSeq) interferon beta 1, fibroblast
  KO
K05415  interferon beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15977 (Ifnb1)
   04668 TNF signaling pathway
    15977 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    15977 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15977 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15977 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15977 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    15977 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    15977 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    15977 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    15977 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15977 (Ifnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15977 (Ifnb1)
   05161 Hepatitis B
    15977 (Ifnb1)
   05160 Hepatitis C
    15977 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    15977 (Ifnb1)
   05164 Influenza A
    15977 (Ifnb1)
   05162 Measles
    15977 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    15977 (Ifnb1)
   05163 Human cytomegalovirus infection
    15977 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15977 (Ifnb1)
   05169 Epstein-Barr virus infection
    15977 (Ifnb1)
   05165 Human papillomavirus infection
    15977 (Ifnb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    15977 (Ifnb1)
   05152 Tuberculosis
    15977 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    15977 (Ifnb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    15977 (Ifnb1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    15977 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15977 (Ifnb1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15977 (Ifnb1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15977
NCBI-ProteinID: NP_034640
MGI: 107657
Ensembl: ENSMUSG00000048806
UniProt: P01575 Q0VE17
Structure
LinkDB
Position
4:complement(88440262..88441031)
AA seq 182 aa
MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIP
MEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLE
EKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNF
QN
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaacaacaggtggatcctccacgctgcgttcctgctgtgcttctccaccacagccctc
tccatcaactataagcagctccagctccaagaaaggacgaacattcggaaatgtcaggag
ctcctggagcagctgaatggaaagatcaacctcacctacagggcggacttcaagatccct
atggagatgacggagaagatgcagaagagttacactgcctttgccatccaagagatgctc
cagaatgtctttcttgtcttcagaaacaatttctccagcactgggtggaatgagactatt
gttgtacgtctcctggatgaactccaccagcagacagtgtttctgaagacagtactagag
gaaaagcaagaggaaagattgacgtgggagatgtcctcaactgctctccacttgaagagc
tattactggagggtgcaaaggtaccttaaactcatgaagtacaacagctacgcctggatg
gtggtccgagcagagatcttcaggaactttctcatcattcgaagacttaccagaaacttc
caaaactga

DBGET integrated database retrieval system