KEGG   Mus musculus (house mouse): 16002
Entry
16002             CDS       T01002                                 
Symbol
Igf2, AL033362, Igf-2, Igf-II, M6pr, Mpr, Peg2
Name
(RefSeq) insulin-like growth factor 2
  KO
K13769  insulin-like growth factor 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16002 (Igf2)
   04014 Ras signaling pathway
    16002 (Igf2)
   04151 PI3K-Akt signaling pathway
    16002 (Igf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16002 (Igf2)
   05205 Proteoglycans in cancer
    16002 (Igf2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16002 (Igf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16002 (Igf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16002 (Igf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16002 (Igf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   16002 (Igf2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 16002
NCBI-ProteinID: NP_001116208
MGI: 96434
Ensembl: ENSMUSG00000048583
Vega: OTTMUSG00000035324
UniProt: P09535
LinkDB
Position
7:complement(142204505..142220566)
AA seq 180 aa
MGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRAN
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFQYDTWR
QSAGRLRRGLPALLRARRGRMLAKELKEFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ
NT seq 543 nt   +upstreamnt  +downstreamnt
atggggatcccagtggggaagtcgatgttggtgcttctcatctctttggccttcgccttg
tgctgcatcgctgcttacggccccggagagactctgtgcggaggggagcttgttgacacg
cttcagtttgtctgttcggaccgcggcttctacttcagcaggccttcaagccgtgccaac
cgtcgcagccgtggcatcgtggaagagtgctgcttccgcagctgcgacctggccctcctg
gagacatactgtgccacccccgccaagtccgagagggacgtgtctacctctcaggccgta
cttccggacgacttccccagataccccgtgggcaagttcttccaatatgacacctggaga
cagtccgcgggacgcctgcgcagaggcctgcctgccctcctgcgtgcccgccggggtcgc
atgcttgccaaagagctcaaagagttcagagaggccaaacgtcatcgtcccctgatcgtg
ttaccacccaaagaccccgcccacgggggagcctcttcggagatgtccagcaaccatcag
tga

DBGET integrated database retrieval system