Mus musculus (house mouse): 16002 Help Entry 16002             CDS       T01002                                  Symbol Igf2, Igf-2, Igf-II, M6pr, Mpr, Peg2 Name (RefSeq) insulin-like growth factor 2   KO K13769   insulin-like growth factor 2 Organism mmu  Mus musculus (house mouse) Pathway mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04081   Hormone signaling mmu04151   PI3K-Akt signaling pathway mmu05200   Pathways in cancer mmu05205   Proteoglycans in cancer mmu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     16002 (Igf2)    04014 Ras signaling pathway     16002 (Igf2)    04151 PI3K-Akt signaling pathway     16002 (Igf2)   09133 Signaling molecules and interaction    04081 Hormone signaling     16002 (Igf2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16002 (Igf2)    05205 Proteoglycans in cancer     16002 (Igf2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     16002 (Igf2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     16002 (Igf2)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     16002 (Igf2) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Growth factors (RTK binding)    16002 (Igf2) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Growth factors/receptors    16002 (Igf2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IGF2_C Insulin Motif Other DBs NCBI-GeneID:  16002 NCBI-ProteinID:  NP_001116208 MGI:  96434 Ensembl:  ENSMUSG00000048583 UniProt:  P09535 LinkDB All DBs Position 7:complement(142204505..142220566) Genome browser AA seq 180 aa AA seqDB search MGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRAN RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFQYDTWR QSAGRLRRGLPALLRARRGRMLAKELKEFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atggggatcccagtggggaagtcgatgttggtgcttctcatctctttggccttcgccttg tgctgcatcgctgcttacggccccggagagactctgtgcggaggggagcttgttgacacg cttcagtttgtctgttcggaccgcggcttctacttcagcaggccttcaagccgtgccaac cgtcgcagccgtggcatcgtggaagagtgctgcttccgcagctgcgacctggccctcctg gagacatactgtgccacccccgccaagtccgagagggacgtgtctacctctcaggccgta cttccggacgacttccccagataccccgtgggcaagttcttccaatatgacacctggaga cagtccgcgggacgcctgcgcagaggcctgcctgccctcctgcgtgcccgccggggtcgc atgcttgccaaagagctcaaagagttcagagaggccaaacgtcatcgtcccctgatcgtg ttaccacccaaagaccccgcccacgggggagcctcttcggagatgtccagcaaccatcag tga

DBGET integrated database retrieval system