Mus musculus (house mouse): 16151 Help Entry 16151             CDS       T01002                                  Symbol Ikbkg, 1110037D23Rik, IKK[g], NEMO Name (RefSeq) inhibitor of kappaB kinase gamma   KO K07210   inhibitor of nuclear factor kappa-B kinase subunit gamma Organism mmu  Mus musculus (house mouse) Pathway mmu01523   Antifolate resistance mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04062   Chemokine signaling pathway mmu04064   NF-kappa B signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04210   Apoptosis mmu04380   Osteoclast differentiation mmu04620   Toll-like receptor signaling pathway mmu04621   NOD-like receptor signaling pathway mmu04622   RIG-I-like receptor signaling pathway mmu04623   Cytosolic DNA-sensing pathway mmu04625   C-type lectin receptor signaling pathway mmu04657   IL-17 signaling pathway mmu04658   Th1 and Th2 cell differentiation mmu04659   Th17 cell differentiation mmu04660   T cell receptor signaling pathway mmu04662   B cell receptor signaling pathway mmu04668   TNF signaling pathway mmu04920   Adipocytokine signaling pathway mmu04936   Alcoholic liver disease mmu05010   Alzheimer disease mmu05132   Salmonella infection mmu05135   Yersinia infection mmu05142   Chagas disease mmu05145   Toxoplasmosis mmu05160   Hepatitis C mmu05161   Hepatitis B mmu05162   Measles mmu05163   Human cytomegalovirus infection mmu05164   Influenza A mmu05165   Human papillomavirus infection mmu05166   Human T-cell leukemia virus 1 infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05168   Herpes simplex virus 1 infection mmu05169   Epstein-Barr virus infection mmu05170   Human immunodeficiency virus 1 infection mmu05171   Coronavirus disease - COVID-19 mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05208   Chemical carcinogenesis - reactive oxygen species mmu05212   Pancreatic cancer mmu05215   Prostate cancer mmu05220   Chronic myeloid leukemia mmu05221   Acute myeloid leukemia mmu05222   Small cell lung cancer mmu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmu05340   Primary immunodeficiency mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     16151 (Ikbkg)    04064 NF-kappa B signaling pathway     16151 (Ikbkg)    04668 TNF signaling pathway     16151 (Ikbkg)    04151 PI3K-Akt signaling pathway     16151 (Ikbkg)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     16151 (Ikbkg)    04660 T cell receptor signaling pathway     16151 (Ikbkg)    04658 Th1 and Th2 cell differentiation     16151 (Ikbkg)    04659 Th17 cell differentiation     16151 (Ikbkg)    04657 IL-17 signaling pathway     16151 (Ikbkg)    04662 B cell receptor signaling pathway     16151 (Ikbkg)    04062 Chemokine signaling pathway     16151 (Ikbkg)   09158 Development and regeneration    04380 Osteoclast differentiation     16151 (Ikbkg)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16151 (Ikbkg)    05208 Chemical carcinogenesis - reactive oxygen species     16151 (Ikbkg)    05203 Viral carcinogenesis     16151 (Ikbkg)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     16151 (Ikbkg)   09162 Cancer: specific types    05212 Pancreatic cancer     16151 (Ikbkg)    05221 Acute myeloid leukemia     16151 (Ikbkg)    05220 Chronic myeloid leukemia     16151 (Ikbkg)    05215 Prostate cancer     16151 (Ikbkg)    05222 Small cell lung cancer     16151 (Ikbkg)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     16151 (Ikbkg)    05170 Human immunodeficiency virus 1 infection     16151 (Ikbkg)    05161 Hepatitis B     16151 (Ikbkg)    05160 Hepatitis C     16151 (Ikbkg)    05171 Coronavirus disease - COVID-19     16151 (Ikbkg)    05164 Influenza A     16151 (Ikbkg)    05162 Measles     16151 (Ikbkg)    05163 Human cytomegalovirus infection     16151 (Ikbkg)    05167 Kaposi sarcoma-associated herpesvirus infection     16151 (Ikbkg)    05169 Epstein-Barr virus infection     16151 (Ikbkg)    05165 Human papillomavirus infection     16151 (Ikbkg)   09171 Infectious disease: bacterial    05135 Yersinia infection     16151 (Ikbkg)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     16151 (Ikbkg)    05142 Chagas disease     16151 (Ikbkg)   09163 Immune disease    05340 Primary immunodeficiency     16151 (Ikbkg)   09164 Neurodegenerative disease    05010 Alzheimer disease     16151 (Ikbkg)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     16151 (Ikbkg)    05418 Fluid shear stress and atherosclerosis     16151 (Ikbkg)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     16151 (Ikbkg)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     16151 (Ikbkg)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mmu01001]     16151 (Ikbkg) Protein kinases [BR:mmu01001]  Serine/threonine kinases: Other   IKK family [OT]    16151 (Ikbkg) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NEMO CC2-LZ zf_C2H2_10 Zn_SUZ12 Nairovirus_NSm PKC_C2 LLC1 Motif Other DBs NCBI-GeneID:  16151 NCBI-ProteinID:  NP_001154895 MGI:  1338074 Ensembl:  ENSMUSG00000004221 UniProt:  O88522 Q8VC91 Structure PDBPDBj LinkDB All DBs Position X:73436883..73498013 Genome browser AA seq 412 aa AA seqDB search MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQE LRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQ ALKELEQLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGRIRAVSEQ VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAYHQLFQD YDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADI YKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESARIEDMRKRHVETPQPP LLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcacccctggaagaaccagctgagtgagatggtgcagcccagtggtggccca gcagaggaccaggacatgctgggtgaagaatcttctctggggaagcctgcaatgctacat ctgccttcagagcagggtactcctgagaccctccagcgctgcctggaagagaatcaagag ctccgagacgctatccggcagagcaatcagatgctgagggaacgctgtgaggagctgctg catttccaggtcagccagcgggaggagaaggagttccttatgtgcaaattccaggaagcc cggaagctggtggagagactgagcttggagaagcttgatcttcggagtcagagggaacag gccttaaaggagttggagcaactgaagaaatgccaacagcagatggctgaggacaaggcc tctgtgaaagctcaggtgacatcattgctcggagaactccaggagagccagagccgtttg gaggctgccaccaaggatcggcaagctttagagggaaggattcgagcagttagtgagcag gtcagacagctggagagtgagcgggaggtgctacagcagcagcacagcgtccaggtggac cagctgcgtatgcagaaccagagcgtggaggctgccttgcgaatggagcggcaggctgct tcagaggagaagcggaagctggctcagttgcaggcagcctatcaccagctcttccaagac tacgacagccacattaagagcagcaagggcatgcagctggaagatctgaggcaacagctc cagcaagctgaggaggccctggtagccaaacaggaattgattgataagctgaaagaggag gctgagcagcacaagattgtgatggagactgtgccagtcttgaaggcccaggcggatatc tacaaggctgacttccaagctgagaggcatgcccgggagaagctggtggagaagaaggag tatttgcaggagcagctggagcagctgcagcgcgagttcaacaagctgaaagttggctgc catgagtcagccaggattgaggatatgaggaagcggcatgtagagactccccagcctcct ttactccctgctccagctcaccactcctttcatttggccttgtccaaccagcggaggagc cctcctgaagaacctcctgacttctgttgtccgaagtgccagtatcaggctcctgatatg gacactctacagatacatgtcatggagtgcatagagtag

DBGET integrated database retrieval system