Mus musculus (house mouse): 16153 Help Entry 16153             CDS       T01002                                  Symbol Il10, CSIF, If2a, Il-10 Name (RefSeq) interleukin 10   KO K05443   interleukin 10 Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04061   Viral protein interaction with cytokine and cytokine receptor mmu04068   FoxO signaling pathway mmu04625   C-type lectin receptor signaling pathway mmu04630   JAK-STAT signaling pathway mmu04660   T cell receptor signaling pathway mmu04672   Intestinal immune network for IgA production mmu05133   Pertussis mmu05135   Yersinia infection mmu05140   Leishmaniasis mmu05142   Chagas disease mmu05143   African trypanosomiasis mmu05144   Malaria mmu05145   Toxoplasmosis mmu05146   Amoebiasis mmu05150   Staphylococcus aureus infection mmu05152   Tuberculosis mmu05310   Asthma mmu05320   Autoimmune thyroid disease mmu05321   Inflammatory bowel disease mmu05322   Systemic lupus erythematosus mmu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     16153 (Il10)    04068 FoxO signaling pathway     16153 (Il10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     16153 (Il10)    04061 Viral protein interaction with cytokine and cytokine receptor     16153 (Il10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     16153 (Il10)    04660 T cell receptor signaling pathway     16153 (Il10)    04672 Intestinal immune network for IgA production     16153 (Il10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     16153 (Il10)    05133 Pertussis     16153 (Il10)    05150 Staphylococcus aureus infection     16153 (Il10)    05152 Tuberculosis     16153 (Il10)   09174 Infectious disease: parasitic    05146 Amoebiasis     16153 (Il10)    05144 Malaria     16153 (Il10)    05145 Toxoplasmosis     16153 (Il10)    05140 Leishmaniasis     16153 (Il10)    05142 Chagas disease     16153 (Il10)    05143 African trypanosomiasis     16153 (Il10)   09163 Immune disease    05310 Asthma     16153 (Il10)    05322 Systemic lupus erythematosus     16153 (Il10)    05320 Autoimmune thyroid disease     16153 (Il10)    05321 Inflammatory bowel disease     16153 (Il10)    05330 Allograft rejection     16153 (Il10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:mmu04052]     16153 (Il10)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     16153 (Il10) Cytokines and growth factors [BR:mmu04052]  Cytokines   Interleukins    16153 (Il10) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Cytokines    16153 (Il10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 Motif Other DBs NCBI-GeneID:  16153 NCBI-ProteinID:  NP_034678 MGI:  96537 Ensembl:  ENSMUSG00000016529 UniProt:  P18893 Q3U879 A0A7R8GUQ3 Structure PDB LinkDB All DBs Position 1:130947459..130952707 Genome browser AA seq 178 aa AA seqDB search MPGSALLCCLLLLTGMRISRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQ LDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLR MRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcctggctcagcactgctatgctgcctgctcttactgactggcatgaggatcagcagg ggccagtacagccgggaagacaataactgcacccacttcccagtcggccagagccacatg ctcctagagctgcggactgccttcagccaggtgaagactttctttcaaacaaaggaccag ctggacaacatactgctaaccgactccttaatgcaggactttaagggttacttgggttgc caagccttatcggaaatgatccagttttacctggtagaagtgatgccccaggcagagaag catggcccagaaatcaaggagcatttgaattccctgggtgagaagctgaagaccctcagg atgcggctgaggcgctgtcatcgatttctcccctgtgaaaataagagcaaggcagtggag caggtgaagagtgattttaataagctccaagaccaaggtgtctacaaggccatgaatgaa tttgacatcttcatcaactgcatagaagcatacatgatgatcaaaatgaaaagctaa

DBGET integrated database retrieval system