Mus musculus (house mouse): 16189 Help Entry 16189             CDS       T01002                                  Symbol Il4, BSF-1, Il-4 Name (RefSeq) interleukin 4   KO K05430   interleukin 4 Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04151   PI3K-Akt signaling pathway mmu04630   JAK-STAT signaling pathway mmu04640   Hematopoietic cell lineage mmu04657   IL-17 signaling pathway mmu04658   Th1 and Th2 cell differentiation mmu04659   Th17 cell differentiation mmu04660   T cell receptor signaling pathway mmu04664   Fc epsilon RI signaling pathway mmu04672   Intestinal immune network for IgA production mmu05140   Leishmaniasis mmu05200   Pathways in cancer mmu05310   Asthma mmu05320   Autoimmune thyroid disease mmu05321   Inflammatory bowel disease mmu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     16189 (Il4)    04151 PI3K-Akt signaling pathway     16189 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     16189 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     16189 (Il4)    04660 T cell receptor signaling pathway     16189 (Il4)    04658 Th1 and Th2 cell differentiation     16189 (Il4)    04659 Th17 cell differentiation     16189 (Il4)    04657 IL-17 signaling pathway     16189 (Il4)    04664 Fc epsilon RI signaling pathway     16189 (Il4)    04672 Intestinal immune network for IgA production     16189 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16189 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     16189 (Il4)   09163 Immune disease    05310 Asthma     16189 (Il4)    05320 Autoimmune thyroid disease     16189 (Il4)    05321 Inflammatory bowel disease     16189 (Il4)    05330 Allograft rejection     16189 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     16189 (Il4)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     16189 (Il4) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Interleukins    16189 (Il4) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Cytokines    16189 (Il4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 SSFA2_C Motif Other DBs NCBI-GeneID:  16189 NCBI-ProteinID:  NP_067258 MGI:  96556 Ensembl:  ENSMUSG00000000869 UniProt:  P07750 LinkDB All DBs Position 11:complement(53503287..53509492) Genome browser AA seq 140 aa AA seqDB search MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATK NTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESK STSLKDFLESLKSIMQMDYS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgggtctcaacccccagctagttgtcatcctgctcttctttctcgaatgtaccaggagc catatccacggatgcgacaaaaatcacttgagagagatcatcggcattttgaacgaggtc acaggagaagggacgccatgcacggagatggatgtgccaaacgtcctcacagcaacgaag aacaccacagagagtgagctcgtctgtagggcttccaaggtgcttcgcatattttattta aaacatgggaaaactccatgcttgaagaagaactctagtgttctcatggagctgcagaga ctctttcgggcttttcgatgcctggattcatcgataagctgcaccatgaatgagtccaag tccacatcactgaaagacttcctggaaagcctaaagagcatcatgcaaatggattactcg tag

DBGET integrated database retrieval system