Mus musculus (house mouse): 16193 Help Entry 16193             CDS       T01002                                  Symbol Il6, Il-6 Name (RefSeq) interleukin 6   KO K05405   interleukin 6 Organism mmu  Mus musculus (house mouse) Pathway mmu01521   EGFR tyrosine kinase inhibitor resistance mmu01523   Antifolate resistance mmu04060   Cytokine-cytokine receptor interaction mmu04061   Viral protein interaction with cytokine and cytokine receptor mmu04066   HIF-1 signaling pathway mmu04068   FoxO signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04218   Cellular senescence mmu04620   Toll-like receptor signaling pathway mmu04621   NOD-like receptor signaling pathway mmu04623   Cytosolic DNA-sensing pathway mmu04625   C-type lectin receptor signaling pathway mmu04630   JAK-STAT signaling pathway mmu04640   Hematopoietic cell lineage mmu04657   IL-17 signaling pathway mmu04659   Th17 cell differentiation mmu04668   TNF signaling pathway mmu04672   Intestinal immune network for IgA production mmu04931   Insulin resistance mmu04932   Non-alcoholic fatty liver disease mmu04933   AGE-RAGE signaling pathway in diabetic complications mmu04936   Alcoholic liver disease mmu05010   Alzheimer disease mmu05020   Prion disease mmu05022   Pathways of neurodegeneration - multiple diseases mmu05132   Salmonella infection mmu05133   Pertussis mmu05134   Legionellosis mmu05135   Yersinia infection mmu05142   Chagas disease mmu05143   African trypanosomiasis mmu05144   Malaria mmu05146   Amoebiasis mmu05152   Tuberculosis mmu05161   Hepatitis B mmu05162   Measles mmu05163   Human cytomegalovirus infection mmu05164   Influenza A mmu05166   Human T-cell leukemia virus 1 infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05168   Herpes simplex virus 1 infection mmu05169   Epstein-Barr virus infection mmu05171   Coronavirus disease - COVID-19 mmu05200   Pathways in cancer mmu05202   Transcriptional misregulation in cancer mmu05321   Inflammatory bowel disease mmu05323   Rheumatoid arthritis mmu05332   Graft-versus-host disease mmu05410   Hypertrophic cardiomyopathy mmu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     16193 (Il6)    04668 TNF signaling pathway     16193 (Il6)    04066 HIF-1 signaling pathway     16193 (Il6)    04068 FoxO signaling pathway     16193 (Il6)    04151 PI3K-Akt signaling pathway     16193 (Il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     16193 (Il6)    04061 Viral protein interaction with cytokine and cytokine receptor     16193 (Il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     16193 (Il6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     16193 (Il6)    04620 Toll-like receptor signaling pathway     16193 (Il6)    04621 NOD-like receptor signaling pathway     16193 (Il6)    04623 Cytosolic DNA-sensing pathway     16193 (Il6)    04625 C-type lectin receptor signaling pathway     16193 (Il6)    04659 Th17 cell differentiation     16193 (Il6)    04657 IL-17 signaling pathway     16193 (Il6)    04672 Intestinal immune network for IgA production     16193 (Il6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     16193 (Il6)    05202 Transcriptional misregulation in cancer     16193 (Il6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     16193 (Il6)    05161 Hepatitis B     16193 (Il6)    05171 Coronavirus disease - COVID-19     16193 (Il6)    05164 Influenza A     16193 (Il6)    05162 Measles     16193 (Il6)    05168 Herpes simplex virus 1 infection     16193 (Il6)    05163 Human cytomegalovirus infection     16193 (Il6)    05167 Kaposi sarcoma-associated herpesvirus infection     16193 (Il6)    05169 Epstein-Barr virus infection     16193 (Il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     16193 (Il6)    05135 Yersinia infection     16193 (Il6)    05133 Pertussis     16193 (Il6)    05134 Legionellosis     16193 (Il6)    05152 Tuberculosis     16193 (Il6)   09174 Infectious disease: parasitic    05146 Amoebiasis     16193 (Il6)    05144 Malaria     16193 (Il6)    05142 Chagas disease     16193 (Il6)    05143 African trypanosomiasis     16193 (Il6)   09163 Immune disease    05323 Rheumatoid arthritis     16193 (Il6)    05321 Inflammatory bowel disease     16193 (Il6)    05332 Graft-versus-host disease     16193 (Il6)   09164 Neurodegenerative disease    05010 Alzheimer disease     16193 (Il6)    05020 Prion disease     16193 (Il6)    05022 Pathways of neurodegeneration - multiple diseases     16193 (Il6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     16193 (Il6)    05410 Hypertrophic cardiomyopathy     16193 (Il6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     16193 (Il6)    04932 Non-alcoholic fatty liver disease     16193 (Il6)    04931 Insulin resistance     16193 (Il6)    04933 AGE-RAGE signaling pathway in diabetic complications     16193 (Il6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     16193 (Il6)    01523 Antifolate resistance     16193 (Il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     16193 (Il6) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Interleukins    16193 (Il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 Motif Other DBs NCBI-GeneID:  16193 NCBI-ProteinID:  NP_112445 MGI:  96559 Ensembl:  ENSMUSG00000025746 UniProt:  P08505 A2RTD1 Structure PDB LinkDB All DBs Position 5:30218112..30224973 Genome browser AA seq 211 aa AA seqDB search MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLW EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY HSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLES QKEWLRTKTIQFILKSLEEFLKVTLRSTRQT NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggataccact cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac caaactggatataatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac catagctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga gtccttcagagagatacagaaactctaattcatatcttcaaccaagaggtaaaagattta cataaaatagtccttcctaccccaatttccaatgctctcctaacagataagctggagtca cagaaggagtggctaaggaccaagaccatccaattcatcttgaaatcacttgaagaattt ctaaaagtcactttgagatctactcggcaaacctag

DBGET integrated database retrieval system