Mus musculus (house mouse): 170779 Help Entry 170779            CDS       T01002                                  Symbol Cd209d, SIGN-R3, SIGNR3, mSIGNR3 Name (RefSeq) CD209d antigen   KO K06563   C-type lectin domain family 4 member L/M Organism mmu  Mus musculus (house mouse) Pathway mmu03260   Virion - Human immunodeficiency virus mmu03264   Virion - Flavivirus and Alphavirus mmu03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mmu03273   Virion - Lassa virus and SFTS virus mmu04145   Phagosome mmu04625   C-type lectin receptor signaling pathway mmu05152   Tuberculosis mmu05162   Measles Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     170779 (Cd209d)    03264 Virion - Flavivirus and Alphavirus     170779 (Cd209d)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     170779 (Cd209d)    03273 Virion - Lassa virus and SFTS virus     170779 (Cd209d)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     170779 (Cd209d)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     170779 (Cd209d)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     170779 (Cd209d)   09171 Infectious disease: bacterial    05152 Tuberculosis     170779 (Cd209d)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     170779 (Cd209d)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mmu04054]     170779 (Cd209d)    04090 CD molecules [BR:mmu04090]     170779 (Cd209d)    04091 Lectins [BR:mmu04091]     170779 (Cd209d) Membrane trafficking [BR:mmu04131]  Endocytosis   Phagocytosis    C-lectin receptors     170779 (Cd209d) Pattern recognition receptors [BR:mmu04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    170779 (Cd209d) CD molecules [BR:mmu04090]  Proteins   170779 (Cd209d) Lectins [BR:mmu04091]  C-Type lectins   Asialoglycoprotein and DC receptors    170779 (Cd209d) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C HERV-K_REC Motif Other DBs NCBI-GeneID:  170779 NCBI-ProteinID:  NP_570974 MGI:  2157947 Ensembl:  ENSMUSG00000031495 UniProt:  Q91ZW8 Q3UW57 LinkDB All DBs Position 8:complement(3921824..3928548) Genome browser AA seq 237 aa AA seqDB search MSDSMESKTQQVVIPEDEECLMSGTRYSDISSRLQTKFGIKSLAEYTKQSRNPLVLQLLS FLFLAGLLLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFFNGSCYFF SKSQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARGPTWMGLSDMHNEATWHWVD GSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSCDKLLFWICKKVSTSSCTTK NT seq 714 nt NT seq  +upstreamnt  +downstreamnt atgagtgactccatggaatcaaagacacagcaagtggtcattccagaggatgaagagtgt ttgatgagtggcaccaggtattctgatatcagctcccgattacaaacaaaatttggaatc aagagtttggcagagtatacgaagcagagccgcaaccccttggtcctgcagctgctttcc ttcctgttcttggctgggcttctgctgatcattctgatcctagtgtcaaaggtccccagc tcagaggttcagaacaaaatctaccaggagctcatgcaactgaaggctgaagttcatgat ggcttgtgccaaccctgcgccagggactggacattcttcaatggaagctgttacttcttc tccaagtcccaaagaaattggcacaactccaccactgcctgccaggaactgggggcccaa ctggtcatcatagagactgatgaggagcagactttcctgcagcagacttctaaggctaga ggaccaacctggatgggtctctcagacatgcataatgaagccacatggcactgggtggat ggctcacctctgtcacccagctttacacgctattggaatagaggggagcccaacaatgtc ggtgatgaagattgtgcagagttctctggggatggctggaatgatctcagttgtgataaa ctacttttctggatctgtaagaaagtttcaacctcatcatgcaccaccaaatga

DBGET integrated database retrieval system