KEGG   Mus musculus (house mouse): 18626
Entry
18626             CDS       T01002                                 
Symbol
Per1, Hftm, Per, m-rigui, mPer1
Name
(RefSeq) period circadian clock 1
  KO
K21944  period circadian protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18626 (Per1)
   04713 Circadian entrainment
    18626 (Per1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18626 (Per1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    18626 (Per1)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 18626
NCBI-ProteinID: NP_001152839
MGI: 1098283
Ensembl: ENSMUSG00000020893
UniProt: O35973
Structure
LinkDB
Position
11:68985934..69000791
AA seq 1291 aa
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGP
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGV
LLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
SLDSDIQELSEQIHRLLLQPVHSSSPTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PVPDQASLALAPEEPERKETSGCSYQQINCLDSILRYLESCNIPSTTKRKCASSSSYTAS
SASDDDKQRAGPVPVGAKKDPSSAMLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTS
QCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPTPDAYRPVGLTK
AVLSLHTQKEEQAFLNRFRDLGRLRGLDTSSVAPSAPGCHHGPIPPGRRHHCRSKAKRSR
HHHHQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAMVQPYPLPVFSPRGGPQPLPPA
PTSVSPATFPSPLVTPMVALVLPNYLFPTPPSYPYGVSQAPVEGPPTPASHSPSPSLPPP
PLSPPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEETAEPE
ARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGST
SASITRSSQSSHTSKYFGSIDSSEAEAGAARARTEPGDQVIKCVLQDPIWLLMANADQRV
MMTYQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRALDVTA
CVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGCGVGGGGGDGGEEAQTQIGAK
GSSSQDSAMEEEEQGGGSSSPALPAEENSTS
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgagtggtcccctagaaggggccgatgggggaggagaccccaggcccggagaacctttt
tgtcctggaggagtcccatcccctggggccccgcagcaccggccttgtccaggccccagc
ctggctgatgacactgatgcaaacagcaatggctcaagtggcaatgagtccaacggaccc
gagtccaggggcgcatctcagcggagttctcatagttcctcttctggcaatggcaaggac
tcagctctgctggagaccactgagagcagcaagagtacaaactcacagagcccatcccca
cccagcagctccattgcctacagcctcctgagtgcgagctcagagcaggacaacccatct
accagtggctgcagcagtgaacagtcagctcgagccaggacccagaaagaactcatgact
gcacttcgggagctcaaacttcgactgccaccagagcgtcggggcaagggccgctctggg
accttggccacactgcagtacgctctggcctgtgtcaagcaggttcaggctaaccaggaa
tattaccagcagtggagtctggaggagggtgagccttgtgccatggacatgtctacttac
accctggaggaattggagcatatcacatccgaatacacacttcgaaaccaggacaccttc
tctgtggctgtgtccttcctgacaggccggattgtctatatttcggagcaggcaggtgtc
ctgctgcgttgcaaacgggatgtgtttcggggtgcccgcttctcagagctcctggctccc
caggatgtgggtgtcttctatggctctactacaccatctcgactgcccacctggggcact
ggcacctctgcaggttcaggtctcaaggacttcacccaggaaaagtctgtcttctgccga
atcagaggaggtcctgaccgggatccagggcctcggtaccagccattccgcctaacccca
tatgtgaccaagattcgggtctcagatggagcccctgcacagccgtgctgcctactcatt
gccgagcgcatccactctggttatgaagctccccggatccctcctgacaagaggatcttc
accacccgacacacaccaagctgcctcttccaggatgtagatgaaagggctgccccactg
ctgggttaccttccccaggatctcctgggggctccagtacttctctttctacatcctgag
gaccgacccctcatgctggccattcataagaagatactgcagctggcaggccagcccttt
gaccattcccctattcgcttctgtgctcggaacggggaatatgtcaccatggacaccagc
tgggccggttttgtgcacccctggagccgcaaggtggctttcgtgttgggtcgccataaa
gtgcgcacggcacccctgaatgaggacgtcttcactcccccagcccccagcccagctccg
tccctggactctgatatccaggagctctcagagcagatccatcgattgctgctgcagcct
gtgcacagctccagccccacggggctctgtggagttggccctctgatgtcccctggtcct
ctacacagccctggctcctccagtgatagcaatgggggggacgctgaggggcctgggcct
cctgctccagtgactttccagcagatctgtaaggatgtgcatctggtaaagcaccaggga
caacagctcttcattgaatctcgggccaagcccccaccccggccccgcctccttgctaca
ggtacattcaaagccaaagtccttccctgccagtccccaaaccccgaactggaggtggcc
ccagttcctgaccaagcctcgttagccttggcccctgaggagccagagaggaaagaaacc
tctggctgttcctaccagcagatcaactgcctggacagcatcctcaggtatttggagagc
tgcaacattcccagtacaaccaagcgtaaatgtgcctcctcctcctcctacactgcctct
tcagcctctgatgatgacaagcagagggcaggtccagttcctgtgggggccaagaaagat
ccgtcgtcagcaatgctgtctggggagggggcaactcctcggaaggagccagtggtggga
ggcaccctgagcccgctcgccctggccaataaggcagagagcgtggtgtccgtcaccagt
cagtgtagcttcagctccaccatcgtccatgtgggagacaagaagcccccggagtcggac
atcatcatgatggaagacctgcctggcctggcccctggcccagcccccagtccggccccc
agccccacagtagcccctgacccaaccccagatgcttatcgcccagtgggtctgaccaag
gccgtgctgtccctgcacacacagaaggaagagcaagccttcctcaaccgcttcagagat
cttggcaggcttcgtggacttgacacctcttctgtggccccctcagcccctggctgccac
catggccccattccccctggtcgccgacaccactgccgatctaaagcaaagcgttcccgc
caccaccaccaccagaccccccggcccgaaactccctgctatgtctcccatccttcacct
gtgccctcttctggaccctggccacccccaccagccacgacccccttcccagcaatggtc
cagccctacccactcccagtattctcccctcgaggaggaccccagccccttccccctgcc
cctacatctgtgtcccctgctaccttcccttctcccttagtgaccccaatggtggccttg
gtgctccctaactatctattccctaccccacctagttatccatatggggtgtcccaggcc
cctgttgaggggccacccacgcctgcttcccactcgccctctccatccctgcccccacca
cctctcagccccccccaccgcccagactccccactgttcaactcgagatgcagctcccca
ctccagctcaatctgctgcagcttgaggagtccccccgcacggaggggggcgctgctgca
ggaggcccaggaagcagtgctgggcccctgcctcccagtgaggagactgctgagccagag
gccagattggtggaggttactgagtcgtccaatcaggatgcactttcaggctccagcgac
ctgctggagctactgctccaagaagactctcgctcgggcacaggctccgcagcctcaggc
tccctgggctctggcctgggctctgggtctggttcaggatcccacgaagggggaagcacc
tcagccagcatcacccgcagcagtcagagcagccatacaagcaagtactttggcagcatc
gactcttccgaggctgaagctggggctgctcgggccaggactgagcctggggaccaggtc
attaagtgtgtgctccaggaccccatctggctgctcatggccaatgccgaccagcgtgtc
atgatgacataccaggtgccgtccagggatgcagcctctgtgctgaagcaagaccgggag
aggctccgggccatgcagaaacagcagccacggttctcagaggaccagaggcgggaactg
ggtgctgtgcactcctgggtccggaagggccagctgcctcgggcccttgatgtgacggcg
tgtgtggactgtggcagcagcgttcaagatcctggccactctgatgaccccctcttctca
gaactggatggattggggctggagcccatggaagagggtggaggcgagggtggtgggtgt
ggtgttggcggtggtgggggtgatggtggtgaggaggcccagacccaaattggggctaag
ggttcaagctctcaggactctgccatggaggaagaagagcaaggtgggggctcatccagc
ccagctttacctgcagaagaaaacagcaccagctag

KEGG   Mus musculus (house mouse): 18627
Entry
18627             CDS       T01002                                 
Symbol
Per2, mKIAA0347, mPer2
Name
(RefSeq) period circadian clock 2
  KO
K02633  period circadian protein 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18627 (Per2)
   04713 Circadian entrainment
    18627 (Per2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18627 (Per2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    18627 (Per2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18627 (Per2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    18627 (Per2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 18627
NCBI-ProteinID: NP_035196
MGI: 1195265
Ensembl: ENSMUSG00000055866
UniProt: O54943 Q8C8R0 A0A0R4J0U3 Q3TW41
Structure
LinkDB
Position
1:complement(91343699..91387072)
AA seq 1257 aa
MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGK
ELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGIT
SEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQ
GAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVA
EMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESC
SEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVP
AYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGT
SRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWL
LMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGG
LPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgaatggatacgtggacttctccccaagtcccaccagtcccaccaaggagccaggggca
cctcagcccacccaggctgtgctccaggaagacgtggacatgagcagtggctccagcgga
aacgagaactgctccacgggacgggactctcagggcagtgactgcgacgacaatgggaag
gagctgcggatgctcgtggaatcttccaacactcaccccagccctgatgatgccttcaga
ctcatgatgacagaggcagagcacaacccctccacgagcggctgcagtagtgagcagtct
gccaaagctgacgcacacaaagaactgataaggaccctgaaggagctgaaggtccacctc
cctgcagacaagaaggccaaggggaaggccagcacgctggcaaccttgaagtatgccctg
cggagcgtgaagcaggtgaaggctaatgaggagtactaccagctgctaatgtccagtgag
agccagccctgcagtgtggatgtgccttcctacagcatggagcaggttgagggcattacc
tccgagtatatcgtgaagaacgcggatatgtttgctgtggctgtgtccctggtttctggg
aagatcctgtacatctctaaccaagtggcctccatctttcactgtaagaaggacgccttc
agtgatgccaagtttgtggagttcctggctcctcatgacgtcagtgtgttccacagctac
accaccccttacaagcttccgccctggagtgtgtgcagcggcttagattctttcactcag
gagtgcatggaggagaaatcttttttctgccgtgtcagtgttgggaaacaccacgagaat
gagattcgctaccagcccttccgcatgacaccctacctggtcaaggtgcaagagcagcag
ggtgctgagagccagctctgctgcctgctgctggcagagagggtacactcgggctatgaa
gcgcctagaatccctcctgagaagaggatcttcacaacaacccacacaccaaactgcttg
ttccaggctgtggatgaaagggcggtccccctcctgggctatctacctcaggatctgatc
gagacgcctgtgctcgtgcagctccaccccagcgaccggcccttgatgctcgccatccac
aagaagatcctacaggccggtggacagcctttcgattattctcccattcgattccgcacc
cgcaacggggagtacatcacactggacactagctggtccagcttcatcaacccgtggagc
aggaagatatctttcatcattgggaggcacaaagtcagggtaggccctttgaatgaggat
gtgttcgcagcctccccgtgcccagaggagaagactccgcaccccagcgttcaggagctc
acagaacaaatccaccggctactgatgcagcctgtcccccacagcggctccagtggctat
gggagcctgggcagtaacggatcccacgaacacctcatgagccagacatcatccagcgac
agcaatggccaagaggagtctcaccggaggagatccggaatttttaaaaccagtggcaag
attcaaaccaaaagtcacgtttctcatgagtctggaggacagaaggaagcatctgttgca
gaaatgcaaagcagccccccagctcaggtgaaagctgtcaccaccatagaaagggacagc
tcaggggccagcctacccaaggccagcttcccagaggaactagcctataagaaccagcct
ccttgctcctaccagcagatcagctgcctggacagtgtcatcaggtacctggagagctgc
agcgaggcagccaccctgaaaaggaagtgcgagttcccagccaacatcccatcccggaag
gccacagtcagccccgggctgcactctggagaggcagcgcggccctccaaggtgaccagc
cacacagaggtcagtgctcacctgagctccctgacgctgccaggcaaggccgagagtgtg
gtgtccctcaccagccagtgcagctacagcagcaccatcgtgcatgtgggcgacaaaaag
ccacagcccgagctagagacggtagaagatatggccagtgggcccgagtccctggatggt
gcggccggcggcctcagccaagaaaaggggcctcttcagaagttgggcctcaccaaggaa
gttctggctgcacatacacagagagaggagcagggcttcctgcagaggttcagggaggtg
agcaggctcagtgccctgcaggctcactgccagaactatctccaggagcggtcccgagcc
caggcgagtgatcgaggactaagaaatacttctggactagagtcatcttggaaaaaaact
ggaaagaacaggaaactgaagtcaaaacgcgtcaagactcgggactcttctgagagcaca
gggtctggaggaccagtgtcccaccgacctcccctcatgggcctgaatgccacagcctgg
tcaccctccgacacatcccagtccagctgcccctctgcacccttccccaccgcagtgcca
gcttaccccctacctgtgttccaggcacccggaatagtatccacaccagggacggtggtg
gcgccacctgcagccacccacactggcttcaccatgcctgttgtgcctatgggcacccag
cctgaattcgcagtgcagcccctgccattcgctgcccctttggctcctgtcatggccttc
atgctgcccagctacccgttcccaccagcaaccccaaacctgcctcaggccttcctcccc
agccagcctcactttccagcccaccccacacttgcctccgaaataactcctgcctcccag
gctgagttccctagtcggacctcgacgctcagacagccgtgcgcttgcccagtcacccct
ccagccggcacagtggccctgggcagagcctccccaccgctcttccagtccagaggcagt
agtcccctacaacttaacctgcttcagctagaggaggcgcctgaaggcagcactggagcc
gcagggaccctggggaccacagggacagcagcttctggtctggactgcacatctggcaca
tctcgggatcggcagccaaaggcacctccaacatgcaacgagccctcagacactcagaac
agtgatgccatctccacgtcaagtgacctgctcaacctccttctgggcgaggacctctgc
tcggccactggctcagccctgtctagaagcggggcatccgccacctcagactctctgggc
tccagctcgctgggcttcggcacatcccaaagtggggcaggcagtagtgacacaagtcac
accagcaaatactttggaagcattgactcttcagagaataatcacaaagcaaaaatgatc
ccagacacggaggaaagcgagcagttcattaagtacgtcttgcaggaccccatctggctg
ctgatggccaacacagacgacagcatcatgatgacataccagctgccctcccgggatctc
caggcggtgttgaaggaggaccaggagaagctgaagctgctgcagaggtcccagccccgg
ttcacagagggccagaggcgagagctccgagaggttcatccgtgggtccacactgggggc
ctgcctacggccatcgatgtgacaggctgtgtttactgcgagagtgaggagaaaggcaac
atttgcctgccatatgaggaagacagtccttccccgggactctgtgatacctcagaagcc
aaagaggaggaaggtgaacagctgacaggccccaggatagaggcccagacgtaa

KEGG   Mus musculus (house mouse): 18628
Entry
18628             CDS       T01002                                 
Symbol
Per3, 2810049O06Rik, mPer3
Name
(RefSeq) period circadian clock 3
  KO
K21945  period circadian protein 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18628 (Per3)
   04713 Circadian entrainment
    18628 (Per3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18628 (Per3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    18628 (Per3)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 18628
NCBI-ProteinID: NP_035197
MGI: 1277134
Ensembl: ENSMUSG00000028957
UniProt: O70361
Structure
LinkDB
Position
4:complement(151081475..151129167)
AA seq 1113 aa
MDPCGDPAVPGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHEDRNRMSEELIMVVQE
MKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGAHQADVTVYSLEDLTAL
ASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYA
HTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQ
PEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIG
TSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWS
RKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPVHASASSGYG
SLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQVYASVNKIKNVGQQLYIESMARS
SVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGSGGNLQQEQPSSSYQQMNCIDSVI
RYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDSSQRDTEQLLDIRKQETTGPSTDIE
GGAARTLSTAALSVASGISQCSCSSTSGHAPPLQSESVAVACKPWALRTKASHLAAGGFK
HVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYGCYLQQESRNRAQYSCVQAGSTAKHSR
CAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTGLLPDEQHWGPSASPSPLGAGLAFPSAL
VVPSQTPYLLPSFPLQDMASQGVGVSAAWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIF
LHNAPLFPLWPPSFSPYPSLGAAGSSELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSE
ELPFISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGE
LATATAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMI
ERTPECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAP
QEGHLQSCVACEDRGSVGDTAEVLEQHPAEDTS
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggatccctgtggagacccggcagtacctggtggcgactgtccccagactaggggaccg
gggctccagggggcgtctggccaggagggtcctctgcagggcacttgcgtggacagcagc
cacagtgaacacgaagaccgaaacagaatgtctgaagagcttataatggttgtccaagaa
atgaaaaagtatttcccagccgagaggcacactaagcccagtaccctagatgctcttaac
tatgccctgcgctgtgtacacagtgtgcaagcaaacagtgactttttccagagtctcggt
ccacgcggagcacaccaggcagatgtgactgtatacagtcttgaggacctcaccgctctg
gcttctgaacatacttctaagaacacagataccttcgcggccgtgttttcgtttctgtct
ggaaggttagtgcacatttctgagcaggctgctttgatcctgaattctaagaggggtttc
ctcaagagcgtgcactttgtcgacctgcttgcccctcaagacgtgagggcgttctacgcg
cacactgctccaactcagcttcctttctggaacaactggacccaaagagcctcgcagtat
gaatgtgcaccagcgaaaccctttttctgcagaatctgtggaggtggagacagagagaag
aggcattactccccattccggatcctcccctatttggttcatgtacatagctctgcccag
ccagaaccagagccttgctgtctaacactggttgaaaagattcactctggttacgaagct
cctcgaatccctgtagataaaagaatttttaccacaacacacactccaggatgtgtgttt
cttgaagtagatgaaagagcagtgcctttgctgggttacctacctcaggatctgattgga
acatcgatcttaacatacttgcacccagaagatcggcctctgatggttgccatacaccaa
aaagttttaaagtatgccggccaccctccgtttgaacactcgcccgtcagattctgcact
cagaacggagagtatgtcattctggattccagctggtccagctttgtcaacccctggagc
cggaaggtctccttcatcattggtcgacataaagtccgaacgagtccattaaatgaagat
gtttttgccaccagaataaaaaaggcagccagtaacgacaaagacatagcagaattacaa
gaacaaattcacaaacttctcttgcagccggttcatgctagtgcttccagtggctacggg
agcctgggcagcagcggctcacaggagcagcacgtcagcatcacctcttcgagtgagtcc
agcgggcactgtccggaggaaggccagcatgagcagatgaccctgcagcaggtctatgcc
agtgtaaacaaaattaagaatgtgggccaacagctctacatcgagtccatggccagatca
tcagtgaagccagtggcagagacgtgcgtggaaccgcagggtggtgatgagcagaaggac
ttttcttcctctcagacactgaaaaataaaagcaccacggatactggctccggtggcaat
ctgcagcaagagcagcccagctcgtcctatcagcagatgaactgtatcgacagtgtcatc
aggtacctgacaagctacagcctcccggccttgaaaagaaagtgcatctcctgcacaaac
acatcttcatcctcagaagaagccaagccaatcccggaggtggacagcagccagagagac
acggaacagctcctggacatacggaaacaggaaacaactggaccatccacagacatcgaa
ggaggtgctgctcggaccctgtccaccgccgcactgagcgtggcgtctggcatcagccag
tgcagctgcagcagcacctctggccacgctccgcccctacagtcagaaagtgttgccgtg
gcgtgtaagccgtgggccctgagaacgaaggcctctcacctggctgcaggaggatttaag
cacgtggggctcacagcagctgtcctctctgcacacacacagaaggaagagcagaactac
gttgacaggttccgggaaaagatcctgacctcgccctacggttgctatcttcagcaagag
agcagaaaccgtgctcagtactcctgtgttcaagcagggtccactgctaagcacagcaga
tgtgctggaagcgagaggcagaagcacaaacgaaagaagttgccagcacctgtggacacc
agcagccccggtgcccacctctgtccccatgtcacaggactcctcccggatgagcagcac
tggggcccatccgctagcccctcccccctcggcgcaggcttagcattcccctcggccctg
gtagttcccagccagaccccttatctcctcccctcttttcccctccaagatatggcctct
cagggagtgggggtctcggcagcctggggagctgcagccggatgtccacctctgtccgcc
ggcccccaggctgttgccgcgttcccctccgcttacgtggatactttgatgaccatcttc
ctgcacaacgcccctctcttccctctgtggccgccctcgttctccccatacccatccctg
ggggccgcagggtcttctgaactggcacccttagtaccagcaatggctccaaacccggaa
ccaaccacttcaggccacagccaaaggagagtggaggagaactgggaggcacacagtgaa
gagcttccgttcattagctcacggagcagttcaccgttacagttaaatttactccaggaa
gaaatgcctgcgccgtcagagtccgcagacgcagtgagaagaggcgctgggccagacgct
aagcatcactgtgttacaggtcccagtggcagtaggagccgtcactgcacctctggtgag
ctggccacggcaacagcgcagcaggagtctgctgctgcctcaggaagcagtgccagcagt
atatacttcagtagcactgactatgcttctgaagtctctgaaaacagacagaggccacag
gatagacagagagacgaagcccttcccggggcggctgaagagtccatctggagaatgata
gagcggacaccagagtgtgttctcatgacataccaggtgcccgagaggggtcgagaggag
gtgctgaagcaggacctggagaagctccagagcatggaacagcagcagcccctgttctct
cccgcgcagagggaggagctggccaaggtgcgctcctggatccacagccacacagcccct
caggagggacacctccagagctgtgtcgcctgtgaagacagaggttcagtgggtgacact
gcagaggtcctggaacagcacccagcagaagacaccagttga

DBGET integrated database retrieval system