KEGG   Mus musculus (mouse): 18976Help
Entry
18976             CDS       T01002                                 

Gene name
Pomc, ACTH, BE, Beta-LPH, Clip, Gamma-LPH, Npp, Pomc-1, Pomc1, alpha-MSH, alphaMSH, beta-MSH, gamma-MSH
Definition
(RefSeq) pro-opiomelanocortin-alpha
  KO
K05228  proopiomelanocortin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04916  Melanogenesis
mmu04920  Adipocytokine signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    18976 (Pomc)
   04916 Melanogenesis
    18976 (Pomc)
   04925 Aldosterone synthesis and secretion
    18976 (Pomc)
   04927 Cortisol synthesis and secretion
    18976 (Pomc)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    18976 (Pomc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPP ACTH_domain Op_neuropeptide
Motif
Other DBs
NCBI-GeneID: 18976
NCBI-ProteinID: NP_001265510
MGI: 97742
Ensembl: ENSMUSG00000020660
UniProt: P01193
LinkDB All DBs
Position
12 A1.1; 12 1.99 cM
AA seq 235 aa AA seqDB search
MPRFCYSRSGALLLALLLQTSIDVWSWCLESSQCQDLTTESNLLACIRACKLDLSLETPV
FPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGSAAQRRAEEEAVWGDGSPEPSPRE
GKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFKRELEGERPLGLEQVLES
DAEKDDGPYRVEHFRWSNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgccgagattctgctacagtcgctcaggggccctgttgctggccctcctgcttcagacc
tccatagatgtgtggagctggtgcctggagagcagccagtgccaggacctcaccacggag
agcaacctgctggcttgcatccgggcttgcaaactcgacctctcgctggagacgcccgtg
tttcctggcaacggagatgaacagcccctgactgaaaacccccggaagtacgtcatgggt
cacttccgctgggaccgcttcggccccaggaacagcagcagtgctggcagcgcggcgcag
aggcgtgcggaggaagaggcggtgtggggagatggcagtccagagccgagtccacgcgag
ggcaagcgctcctactccatggagcacttccgctggggcaagccggtgggcaagaaacgg
cgcccggtgaaggtgtaccccaacgttgctgagaacgagtcggcggaggcctttccccta
gagttcaagagggagctggaaggcgagcggccattaggcttggagcaggtcctggagtcc
gacgcggagaaggacgacgggccctaccgggtggagcacttccgctggagcaacccgccc
aaggacaagcgttacggtggcttcatgacctccgagaagagccagacgcccctggtgacg
ctcttcaagaacgccatcatcaagaacgcgcacaagaagggccagtga

DBGET integrated database retrieval system