Mus musculus (house mouse): 20315 Help Entry 20315             CDS       T01002                                  Symbol Cxcl12, Pbsf, Scyb12, Sdf1, Tlsf, Tpar1 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04061   Viral protein interaction with cytokine and cytokine receptor mmu04062   Chemokine signaling pathway mmu04064   NF-kappa B signaling pathway mmu04360   Axon guidance mmu04670   Leukocyte transendothelial migration mmu04672   Intestinal immune network for IgA production mmu04810   Regulation of actin cytoskeleton mmu05163   Human cytomegalovirus infection mmu05200   Pathways in cancer mmu05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     20315 (Cxcl12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     20315 (Cxcl12)    04061 Viral protein interaction with cytokine and cytokine receptor     20315 (Cxcl12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     20315 (Cxcl12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     20315 (Cxcl12)    04672 Intestinal immune network for IgA production     20315 (Cxcl12)    04062 Chemokine signaling pathway     20315 (Cxcl12)   09158 Development and regeneration    04360 Axon guidance     20315 (Cxcl12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     20315 (Cxcl12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     20315 (Cxcl12)   09163 Immune disease    05323 Rheumatoid arthritis     20315 (Cxcl12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     20315 (Cxcl12)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     20315 (Cxcl12) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Chemokines    20315 (Cxcl12) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Chemokines    20315 (Cxcl12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  20315 NCBI-ProteinID:  NP_038683 MGI:  103556 Ensembl:  ENSMUSG00000061353 UniProt:  P40224 LinkDB All DBs Position 6:117145496..117158329 Genome browser AA seq 93 aa AA seqDB search MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIV ARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggacgccaaggtcgtcgccgtgctggccctggtgctggccgcgctctgcatcagtgac ggtaaaccagtcagcctgagctaccgatgcccctgccggttcttcgagagccacatcgcc agagccaacgtcaagcatctgaaaatcctcaacactccaaactgtgcccttcagattgtt gcacggctgaagaacaacaacagacaagtgtgcattgacccgaaattaaagtggatccaa gagtacctggagaaagctttaaacaagaggctcaagatgtga

DBGET integrated database retrieval system