KEGG   Mus musculus (house mouse): 217944
Entry
217944            CDS       T01002                                 
Symbol
Rapgef5, 4932413M22, D030051B22Rik, GFR, Mrgef, mKIAA0277, mmr-gef
Name
(RefSeq) Rap guanine nucleotide exchange factor (GEF) 5
  KO
K08019  Rap guanine nucleotide exchange factor 5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    217944 (Rapgef5)
   04015 Rap1 signaling pathway
    217944 (Rapgef5)
SSDB
Motif
Pfam: RasGEF DEP RasGEF_N RA DUF2603
Other DBs
NCBI-GeneID: 217944
NCBI-ProteinID: NP_787126
MGI: 2444365
Ensembl: ENSMUSG00000041992
UniProt: Q8C0Q9
LinkDB
Position
12:117480146..117723472
AA seq 814 aa
MTTGDCQTLSRRISNPYLEHSPSQIYGENSSCAGRALRNIIILQAADLVKDRVNLKGFYR
RSCVGSELVDWLLEHCPFVQCRSMAIGVWQLLLDMGIMSSVDQHLYFQDNYVFYQFSSDE
CSYLYCEFEREEEWQKGVKLLLELVHLIPARAGICDLSHQKTEDSEESSDEILARLTSAV
QRELAAVIALKARKSAIEQDDENADKHVTVTEANNGPDPQAGVMCKLQERDDIGRIELVH
KLARENCQFLQTEKKESEKLEQQDDEVTMVQVKEQGQSVLVLKKVASCGPAPTSGSAEND
ARYVVVSGTPEKILEHLLNDLHLAEVQHKETETLLDDFLLTYTVFMTTDDLCQALLRHYS
AKKYQGEEENSDVPCRKRKVLHLVSQWISLYKDWLHEDEHSKMFLKTIYRNVLDDVYEYP
ILEKELKEFQKILGVYRRHTVDEYSPQKKNKALFHQFSLKENWLQHRGTVAETEEIFCHV
YITEHSYISVKAKVSSTAQEILKVVAEKLQRAEEDLALVAITFSGEKHEFQPNDLAISKS
LEASGRIYVYRKDLADTLNPLAENEESQQRSMRILGMNTWDLALELMSFDWSLFNSIHEQ
ELIYFTFSRQGNGENTVNLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKFIKIAAHC
KAQQNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFK
KMKPPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGSDVS
PKEQQELKSYVNHLYVIDSQQALFELSHRLEPRA
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgaccactggtgactgccagactctctcaagaagaatttctaatccataccttgaacat
agtccttctcagatttatggagagaattcttcctgtgcaggaagagcattaaggaatatt
attatccttcaagcagctgacctggtaaaggacagagtgaatctcaaggggttttacagg
agaagctgtgtggggtcagagctggtcgactggctcctggaacactgtccttttgtccag
tgtagatctatggccattggagtctggcagctcctactggatatggggattatgtcatcc
gtggaccaacatctatactttcaagataattatgttttctaccagttttcttcggatgag
tgcagctacttgtactgcgaatttgaaagagaggaagaatggcagaagggagtgaagcta
ttgctggagcttgtgcatctcattcctgcaagagctggcatctgtgacctgtctcaccag
aaaacggaagactcggaggaaagcagtgatgagattcttgctcggctaacatctgcggtg
cagagagagctggcggctgttattgctttgaaagcaagaaagtctgcaattgagcaagat
gatgaaaacgctgacaagcatgtaaccgtgacggaggctaacaacggtcccgatcctcag
gctggggtgatgtgcaagcttcaagagagagatgatatcggacgtattgagctggtccac
aagctggcaagagaaaactgtcagtttttacagacagaaaaaaaagaatcggagaagttg
gaacagcaagatgatgaagtgacgatggttcaggttaaagagcaaggccagagtgtgctg
gtgctgaagaaagtagcaagctgtggcccagcccccacctcagggagtgcggagaacgac
gcgagatatgtggtggtgtctggtaccccggagaagatcttggagcaccttttgaatgac
ttgcacctggcagaggttcagcacaaagaaacagaaacactccttgatgacttcctcctc
acgtacaccgtattcatgacaactgatgacttgtgccaggcgctgctaagacactattct
gccaagaagtatcaaggggaagaagaaaactcagatgtcccttgtcggaagcgcaaggtc
ttacatctggtttcccagtggatttctctgtacaaggactggctacatgaagatgagcat
tcaaaaatgtttctaaagaccatatacaggaacgtgctggatgatgtctatgagtacccg
attcttgagaaagagctgaaagagtttcagaagatacttggcgtgtaccgccgtcacact
gttgatgaatactcaccacagaagaagaataaagcccttttccaccaattcagtcttaag
gagaactggctccagcacagaggaactgtggcagaaacagaggaaattttttgccacgtg
tatataacggagcactcctatatcagtgtgaaggcaaaagtgtcgagtacagcccaggag
atcctgaaggtcgtggccgagaagctgcagcgtgccgaagaggatctggctctggtagcc
attacattctctggagaaaagcatgaatttcagccaaatgacttggccatttccaaatcc
ctggaggcatctggtcggatatatgtctaccgaaaagatctggctgacactttgaatcct
ttggcagaaaatgaggaatcccagcaaaggtcaatgaggattttggggatgaacacgtgg
gaccttgctctggaattaatgagttttgattggagtctgttcaattcaatccacgagcaa
gagctgatctacttcacattcagcagacaggggaacggagagaatactgtgaacctcagc
cttctgctccagagatgtaacgaggtccagctctgggtagccacagagattctgctctgc
agccagctaggcaagcgcgtgcagctggtgaaaaaattcatcaagattgcagctcactgc
aaagcccaacagaacctaaactctttctttgccatcgtgatgggtctcaacaccgcctct
gtcagccggctatcacagacctgggagaaaatccctgggaagtttaagaagcttttctct
gaacttgagagtttaacggatccttccctaaaccacaaagcctacagggatgcgttcaaa
aagatgaagccaccaaaaatccctttcatgcccttactgcttaaagatgtaacgtttatt
catgaaggaaataaaacattcttggataatctcgtcaattttgaaaagctgcacatgatt
gcagacactgtccgaaccctgagacactgcaggactaaccagtttggaagtgacgtgtct
ccaaaggagcagcaagagctgaagtcctatgtcaaccacctgtatgtcatcgacagccag
caagccctgttcgagctctctcacaggctggagcctcgagcctga

DBGET integrated database retrieval system