KEGG   Mus musculus (house mouse): 21825
Entry
21825             CDS       T01002                                 
Symbol
Thbs1, TSP-1, TSP1, Thbs-1, tbsp1
Name
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04115  p53 signaling pathway
mmu04145  Phagosome
mmu04148  Efferocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    21825 (Thbs1)
   04350 TGF-beta signaling pathway
    21825 (Thbs1)
   04151 PI3K-Akt signaling pathway
    21825 (Thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21825 (Thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21825 (Thbs1)
   04148 Efferocytosis
    21825 (Thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    21825 (Thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21825 (Thbs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21825 (Thbs1)
   05205 Proteoglycans in cancer
    21825 (Thbs1)
  09162 Cancer: specific types
   05219 Bladder cancer
    21825 (Thbs1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21825 (Thbs1)
  09174 Infectious disease: parasitic
   05144 Malaria
    21825 (Thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21825 (Thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21825 (Thbs1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21825 (Thbs1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21825 (Thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 cEGF TSP1_ADAMTS Laminin_G_2 Laminin_G_3 EGF TSP1_CCN Laminin_G_1
Other DBs
NCBI-GeneID: 21825
NCBI-ProteinID: NP_001300843
MGI: 98737
Ensembl: ENSMUSG00000040152
UniProt: Q80YQ1 Q3TR40
LinkDB
Position
2:117942357..117957614
AA seq 1170 aa
MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFR
IENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVV
SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELD
VPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDSIRK
VTEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQV
CNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDKNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRQF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDMKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggagctcctgcggggactaggtgtcctgttcctgttgcatatgtgtggaagcaaccgc
attccagagtctgggggagataacggtgtgtttgacatctttgaactcattggaggtgca
cgaaggggccccggtcgccgactggtgaagggccaagatctatccagccccgccttccgc
attgagaatgccaacctgatccccgctgtgccggatgacaagttccaagacctactggac
gctgtgtgggccgacaaaggcttcatcttcctggcttccttgaggcagatgaagaagacc
cggggcacactcctggctgtggaacggaaagacaacactggccagatcttcagtgtggtc
tccaacggcaaagctggcaccctggacctgagcctgagcctgccagggaagcaacaagtg
gtgtcagtggaggaagctctcctggccactggccagtggaagagcatcacgctgtttgtt
caagaggaccgggctcaactctacatagactgtgataagatggagagcgcggagctggat
gtacccatccagagcatcttcaccagggatctggccagcgttgccaggctccgagttgca
aagggagatgtcaatgacaattttcagggggtgctgcagaatgtgaggtttgtctttgga
accaccccagaagacattctcaggaacaaaggctgctccagctctaccaacgtccttctt
acccttgacaacaacgtggtgaacggttccagccctgctatccgcaccaactacatcggc
cacaaaacaaaggacctccaagctatctgtggcctctcctgtgatgaactatccagcatg
gtcctggaactgaagggcctgcgcaccatcgtgaccactctgcaggacagcatccgaaaa
gtgacggaagagaacagagagctggtcagtgagctgaagcggcctcccctctgctttcac
aatggagtccagtacaagaacaacgaggagtggactgtagacagttgcacagagtgtcac
tgccagaactcggttaccatctgcaaaaaggtgtcctgtcccatcatgccctgctccaac
gccacagttcctgatggtgaatgctgcccacggtgctggcccagcgactctgctgacgat
ggctggtctccctggtctgagtggacctcctgctctgccacatgtggcaatggaattcag
caacgtggtcgttcctgtgacagcctcaacaacagatgcgagggctcttcggtacagaca
aggacctgccacattcaggagtgtgacaaaagatttaaacaggatggtggctggagtcac
tggtctccatggtcgtcctgttctgtgacctgtggtgacggtgtgatcacaaggatccgg
ctctgcaactcccccagcccccagatgaacgggaagccctgtgaaggtgaagcccgggag
accaaagcctgcaagaaagacgcctgcccaattaatggaggctggggtccctggtcacca
tgggacatctgctctgtcacctgtggaggaggagtgcagagacgcagccgactctgtaac
aaccccacaccccagtttggaggcaaagactgtgttggcgatgtgacagaaaatcaagtt
tgcaacaagcaggactgcccaattgatggatgcctgtccaatccctgctttgctggtgcc
aagtgtactagctaccctgatggtagctggaaatgtggtgcgtgtcctcctggctacagt
ggaaatggcatccagtgcaaagacgtcgatgagtgcaaagaagtgcctgatgcttgcttc
aatcacaacggagaacatcggtgcaagaacacagatcctggctacaactgcctgccctgc
ccaccacgattcactggctcacagcccttcggccgaggtgtcgaacatgccatggccaac
aaacaggtgtgcaaaccgcgaaacccctgcacggacgggacgcatgactgcaacaagaac
gctaagtgcaactacctgggtcactacagtgaccccatgtaccgctgtgagtgcaagccc
ggctatgcaggcaatggcatcatctgcggagaggacacagacctggacggctggcctaat
gaaaacctggtgtgtgtggccaacgcaacctaccactgcaaaaaggacaactgccccaac
cttcccaactcggggcaggaagactatgacaaggacgggattggcgatgcctgcgatgat
gacgatgacaacgacaagatccccgatgacagggacaactgtccattccattacaaccca
gcccagtatgactatgacagagatgatgtgggagaccgctgtgacaactgcccctacaac
cacaaccctgaccaagcagacacagacaaaaacggggagggcgatgcctgtgctgtggac
atcgatggagatggaatcctcaatgaacgagacaactgccagtacgtttacaacgtggac
cagagggacacggacatggatggggttggagatcagtgtgacaactgccccctggaacac
aatccagaccagctggactctgactcagacctcataggggacacttgtgacaacaatcag
gacatcgatgaggatggccatcagaacaatctggacaactgtccctatgtgcctaatgcc
aaccaggccgaccatgataaagatggcaaaggagatgcctgtgaccatgacgatgacaat
gacggcatccctgatgacagagacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggccgaggtgacgcctgcaaagacgactttgaccatgacaatgtgcca
gatattgatgacatctgtcctgagaattttgacatcagtgaaaccgatttccgacaattc
cagatgattcctctagatcccaaaggaacctcccaaaatgaccctaactgggttgtccgc
catcagggcaaagaacttgtccagactgtaaactgtgaccctggacttgctgtaggttat
gatgagtttaatgctgtggacttcagcggtaccttcttcatcaacaccgagagagatgat
gactacgctggctttgttttcggctaccagtccagcagccgcttctacgttgtgatgtgg
aaacaagtcacccagtcctactgggacaccaaccccacaagggctcagggatactcaggc
ctgtctgtaaaggttgtgaactccaccaccggccctggcgagcacctgcggaatgcactg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgccacatc
ggctggaaagatttcactgcatacagatggcgtctcagccacaggccaaagaccggttat
atcagagtggtgatgtatgaaggaaagaaaatcatggctgactcgggacccatctatgac
aaaacctacgccggcggtagactaggcctgttcgtcttctctcaggaaatggtgttcttc
tcagacatgaaatacgagtgtcgagattcctaa

DBGET integrated database retrieval system