KEGG   Mus musculus (house mouse): 22031
Entry
22031             CDS       T01002                                 
Symbol
Traf3, AI528849, CAP-1, CD40bp, CRAF1, LAP1, T-BAM, TRAFAMN, amn
Name
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    22031 (Traf3)
   04668 TNF signaling pathway
    22031 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    22031 (Traf3)
   04621 NOD-like receptor signaling pathway
    22031 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    22031 (Traf3)
   04657 IL-17 signaling pathway
    22031 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22031 (Traf3)
   05203 Viral carcinogenesis
    22031 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    22031 (Traf3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    22031 (Traf3)
   05160 Hepatitis C
    22031 (Traf3)
   05171 Coronavirus disease - COVID-19
    22031 (Traf3)
   05164 Influenza A
    22031 (Traf3)
   05162 Measles
    22031 (Traf3)
   05168 Herpes simplex virus 1 infection
    22031 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22031 (Traf3)
   05169 Epstein-Barr virus infection
    22031 (Traf3)
   05165 Human papillomavirus infection
    22031 (Traf3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    22031 (Traf3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    22031 (Traf3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 MPS2 Cast Spc29 Tropomyosin_1 zf-RING_4 ATG16 KxDL GAS Crescentin FliJ zf-RING_6 Exonuc_VII_L DUF1664 T3SSipB BLOC1_2 SPATA24
Other DBs
NCBI-GeneID: 22031
NCBI-ProteinID: NP_035762
MGI: 108041
Ensembl: ENSMUSG00000021277
UniProt: Q60803 Q3UHJ1
Structure
LinkDB
Position
12:111132755..111233589
AA seq 567 aa
MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLC
NPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEG
RGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCK
SQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagtcaagcaaaaagatggatgctgctggcacactgcagcctaacccacccctaaag
ctgcagcctgatcgcggcgcagggtccgtgctcgtgccggagcaaggaggctacaaggag
aagtttgtgaagacggtggaagacaagtacaagtgcgagaagtgccgcctggtgctgtgc
aacccgaagcagacggagtgtggccaccggttctgcgagagctgcatggccgccctgctg
agctcctccagtccaaaatgcacagcgtgccaagaaagcatcatcaaagacaaggtgttt
aaggataattgctgcaagagagagattctggcccttcaggtctactgtcggaatgaaggc
agaggttgtgcggagcagctgactctgggacatctgctggtgcacctaaaaaatgaatgt
cagtttgaggaacttccctgtctgcgtgccgactgcaaagaaaaagtactgagaaaagac
ttgcgggatcacgtggaaaaggcctgtaaataccgcgaggccacgtgcagtcactgcaag
agccaagtgcccatgatcaaactgcagaaacatgaagacacagattgtccctgtgtggtg
gtatcctgccctcacaagtgcagcgttcagactcttctaaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccatgaggccagctccgcggtacagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccctgctgcagaatgaaagt
gttgagaaaaacaagagcatccaaagcctgcacaaccagatctgcagctttgagatcgag
attgagaggcagaaggagatgctccgaaacaacgagtccaagatccttcacctgcagcgg
gtaatcgacagccaagcagagaaactgaaagaactggacaaggagatccgtcccttccgg
cagaactgggaggaagcggacagcatgaagagcagtgtggagtccctccagaaccgagtg
actgagctggagagcgtagacaaaagtgcggggcaggcggctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgttgagtgttcatgacatccgcttggccgac
atggacctgcggttccaggtcctcgagaccgccagctacaacggggtgctgatctggaag
atccgtgactacaagcgccggaagcaggaggccgtcatggggaagaccctgtctctctac
agccagcctttctacacaggttattttggctataagatgtgtgccagggtctacctgaat
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgtggagaa
tatgatgctctgttgccatggccgttcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgccgtcatctgggagatgcgttcaagcctgaccccaacagcagcagcttc
aagaaacccaccggagagatgaatatcgcctctggctgcccagtctttgtcgcccaaact
gttctagagaacgggacgtatattaaagatgatacaatctttattaaggtcatagtggat
acctcggatctgcctgacccctga

DBGET integrated database retrieval system