KEGG   Mus musculus (mouse): 22059Help
Entry
22059             CDS       T01002                                 

Gene name
Trp53, Tp53, bbl, bfy, bhy, p44, p53
Definition
(RefSeq) transformation related protein 53
  KO
K04451  tumor protein p53
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04137  Mitophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04216  Ferroptosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22059 (Trp53)
   04310 Wnt signaling pathway
    22059 (Trp53)
   04071 Sphingolipid signaling pathway
    22059 (Trp53)
   04151 PI3K-Akt signaling pathway
    22059 (Trp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    22059 (Trp53)
  09143 Cell growth and death
   04110 Cell cycle
    22059 (Trp53)
   04210 Apoptosis
    22059 (Trp53)
   04216 Ferroptosis
    22059 (Trp53)
   04115 p53 signaling pathway
    22059 (Trp53)
   04218 Cellular senescence
    22059 (Trp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    22059 (Trp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    22059 (Trp53)
  09149 Aging
   04211 Longevity regulating pathway
    22059 (Trp53)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    22059 (Trp53)
   05230 Central carbon metabolism in cancer
    22059 (Trp53)
   05202 Transcriptional misregulation in cancer
    22059 (Trp53)
   05206 MicroRNAs in cancer
    22059 (Trp53)
   05205 Proteoglycans in cancer
    22059 (Trp53)
   05203 Viral carcinogenesis
    22059 (Trp53)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    22059 (Trp53)
   05212 Pancreatic cancer
    22059 (Trp53)
   05225 Hepatocellular carcinoma
    22059 (Trp53)
   05226 Gastric cancer
    22059 (Trp53)
   05214 Glioma
    22059 (Trp53)
   05216 Thyroid cancer
    22059 (Trp53)
   05220 Chronic myeloid leukemia
    22059 (Trp53)
   05217 Basal cell carcinoma
    22059 (Trp53)
   05218 Melanoma
    22059 (Trp53)
   05219 Bladder cancer
    22059 (Trp53)
   05215 Prostate cancer
    22059 (Trp53)
   05213 Endometrial cancer
    22059 (Trp53)
   05224 Breast cancer
    22059 (Trp53)
   05222 Small cell lung cancer
    22059 (Trp53)
   05223 Non-small cell lung cancer
    22059 (Trp53)
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    22059 (Trp53)
   05016 Huntington disease
    22059 (Trp53)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    22059 (Trp53)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    22059 (Trp53)
   05162 Measles
    22059 (Trp53)
   05161 Hepatitis B
    22059 (Trp53)
   05160 Hepatitis C
    22059 (Trp53)
   05168 Herpes simplex infection
    22059 (Trp53)
   05163 Human cytomegalovirus infection
    22059 (Trp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22059 (Trp53)
   05169 Epstein-Barr virus infection
    22059 (Trp53)
   05165 Human papillomavirus infection
    22059 (Trp53)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    22059 (Trp53)
   01522 Endocrine resistance
    22059 (Trp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22059 (Trp53)
   03036 Chromosome and associated proteins [BR:mmu03036]
    22059 (Trp53)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    22059 (Trp53)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    22059 (Trp53)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     22059 (Trp53)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    22059 (Trp53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer P53_TAD
Motif
Other DBs
NCBI-GeneID: 22059
NCBI-ProteinID: NP_035770
MGI: 98834
Ensembl: ENSMUSG00000059552
Vega: OTTMUSG00000005982
UniProt: P02340 Q549C9 Q3UGQ1
LinkDB All DBs
Structure
PDB: 

Position
11 B3; 11 42.83 cM
AA seq 390 aa AA seqDB search
MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEA
LRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVM
CTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCS
DGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCM
GGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGS
AKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSR
AHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactgccatggaggagtcacagtcggatatcagcctcgagctccctctgagccaggag
acattttcaggcttatggaaactacttcctccagaagatatcctgccatcacctcactgc
atggacgatctgttgctgccccaggatgttgaggagttttttgaaggcccaagtgaagcc
ctccgagtgtcaggagctcctgcagcacaggaccctgtcaccgagacccctgggccagtg
gcccctgccccagccactccatggcccctgtcatcttttgtcccttctcaaaaaacttac
cagggcaactatggcttccacctgggcttcctgcagtctgggacagccaagtctgttatg
tgcacgtactctcctcccctcaataagctattctgccagctggcgaagacgtgccctgtg
cagttgtgggtcagcgccacacctccagctgggagccgtgtccgcgccatggccatctac
aagaagtcacagcacatgacggaggtcgtgagacgctgcccccaccatgagcgctgctcc
gatggtgatggcctggctcctccccagcatcttatccgggtggaaggaaatttgtatccc
gagtatctggaagacaggcagacttttcgccacagcgtggtggtaccttatgagccaccc
gaggccggctctgagtataccaccatccactacaagtacatgtgtaatagctcctgcatg
gggggcatgaaccgccgacctatccttaccatcatcacactggaagactccagtgggaac
cttctgggacgggacagctttgaggttcgtgtttgtgcctgccctgggagagaccgccgt
acagaagaagaaaatttccgcaaaaaggaagtcctttgccctgaactgcccccagggagc
gcaaagagagcgctgcccacctgcacaagcgcctctcccccgcaaaagaaaaaaccactt
gatggagagtatttcaccctcaagatccgcgggcgtaaacgcttcgagatgttccgggag
ctgaatgaggccttagagttaaaggatgcccatgctacagaggagtctggagacagcagg
gctcactccagctacctgaagaccaagaagggccagtctacttcccgccataaaaaaaca
atggtcaagaaagtggggcctgactcagactga

DBGET integrated database retrieval system