KEGG   Mus musculus (mouse): 240168Help
Entry
240168            CDS       T01002                                 

Gene name
Rasgrp3, BC066069, Gm327
Definition
(RefSeq) RAS, guanyl releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04662  B cell receptor signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    240168 (Rasgrp3)
   04015 Rap1 signaling pathway
    240168 (Rasgrp3)
   04010 MAPK signaling pathway
    240168 (Rasgrp3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    240168 (Rasgrp3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    240168 (Rasgrp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 RasGEF_N
Motif
Other DBs
NCBI-GeneID: 240168
NCBI-ProteinID: NP_001159965
MGI: 3028579
Ensembl: ENSMUSG00000071042
UniProt: Q6NZH9
LinkDB All DBs
Position
17; 17 E2
AA seq 691 aa AA seqDB search
MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCMYR
NASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISLMDI
SSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNT
LMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTV
QAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggggtccaacgggctcgggaaagcggcaacactagatgaacttctcagcacatgcatt
gagatgtttgatgacaatggagacctgaacgacagttacttgcccagaatcgtgttactg
atgcaccgatggtatttatcctccactgaactggcaggaaaactcctctgcatgtatcgg
aatgccagtggagaaagctgtgatgagttccgactgaagatctgctatttcatgaggtac
tggattctgaaatttcctgcagagtttaatttggatcttggtttgattcgcatgactgag
gagttccgggaagtagctagtcaactaggacatgaaaaacacatcagcctcatggacata
tctagcgttccttcctatgactggatgaggagagtcacacagaggaaaaaagtatccaaa
aggggaaaggcctgcctcttatttgaccatctggagcccattgagttggcggagcacctc
acttttctggagcataaatcttttagaaggatctcattcacagattatcagagctatgtc
atccatggctgtctggagaataacccgacattggagagatctattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaagtgcgcaacaaagggcagaa
gtcatcacaaagttcatcaatgtagcccagaaactccttcaactaaaaaattttaacacc
ttgatggcagtggttggtggccttagtcacagctccatttcccgactcaaagacacccat
tctcacctctcttccgaagttacaaagaactggaatgaaatgacagagttggtctcctcc
aatggcaattactgcaattaccgcaaagcctttgctgactgtgatggcttcaaaatcccc
atccttggcgtgcacttgaaagacttgatagcagtccatgtcattttcccagactggatg
gaggagaacaaagtgaacgttgtgaaaatgcaccagctttctgttaccctgagtgaactg
gtctccctgcagaatgcctctcaccacttggaacctaacatggatttgatcaacctactc
actctctctctggacctctaccacacagaggatgatatttacaaactgtcactggtgttg
gagcctagaaattccaaatcgcagccaacctccccaacgacacctaataagcctgtggta
cctctggagtgggcttcagaagtggtaccaaagccagaccccacaatcatcaacaaacac
ataaggaagttggttgagtctgtgtttcgaaactacgatcatgaccacgatggttacatc
tcccaagaggactttgagagcatagctgccaatttccccttcctggattccttctgcgta
ctagacaaagatcaggacggcctaattagcaaagacgaaatgatggcttatttcctgaga
gctaaatctcagctacactgcaaaatgggaccaggcttcatccataattttcaggagatg
aactatctcaagccgaccttctgcgaacactgtgcgggatttctctggggcataatcaaa
caaggctacaagtgcaaagactgtggagccaactgccacaagcagtgcaaagacctcttg
gttctggcctgcaggagacttgccagggcaccctccttgagcagcaaccccgggtcactg
cctggaagcccagccttgcccccagtgcaggatgaggtatttgagtttcctggggtcacg
gctggacaccgagacctggacagcagagccattaccctggttacaggatcttcccggaag
atctccgtgaggctgcagagagccaccactagtcaagccacccagacggaacctgtgtgg
tcagaggctgtctggggagactcagggtcccataccttccccaaaatgaaatccaagttc
catgacaaagcagcaaaggacaagggctttgccaagtgggaaaacgagaagcccacggta
caagctggtgtggatgttgtagatcgaggcactgcatttgaacctgaccaggatgatggg
caagatgaagccaagcagggtggtgaggatggctga

DBGET integrated database retrieval system