Mus musculus (house mouse): 26970 Help Entry 26970             CDS       T01002                                  Symbol Pla2g2e Name (RefSeq) phospholipase A2, group IIE   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism mmu  Mus musculus (house mouse) Pathway mmu00564   Glycerophospholipid metabolism mmu00565   Ether lipid metabolism mmu00590   Arachidonic acid metabolism mmu00591   Linoleic acid metabolism mmu00592   alpha-Linolenic acid metabolism mmu01100   Metabolic pathways mmu04014   Ras signaling pathway mmu04270   Vascular smooth muscle contraction mmu04972   Pancreatic secretion mmu04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:mmu00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     26970 (Pla2g2e)    00565 Ether lipid metabolism     26970 (Pla2g2e)    00590 Arachidonic acid metabolism     26970 (Pla2g2e)    00591 Linoleic acid metabolism     26970 (Pla2g2e)    00592 alpha-Linolenic acid metabolism     26970 (Pla2g2e)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     26970 (Pla2g2e)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     26970 (Pla2g2e)   09154 Digestive system    04972 Pancreatic secretion     26970 (Pla2g2e)    04975 Fat digestion and absorption     26970 (Pla2g2e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     26970 (Pla2g2e) Enzymes [BR:mmu01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      26970 (Pla2g2e) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     26970 (Pla2g2e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  26970 NCBI-ProteinID:  NP_036174 MGI:  1349660 Ensembl:  ENSMUSG00000028751 UniProt:  Q9QUL3 Q3UG05 LinkDB All DBs Position 4:138605253..138610125 Genome browser AA seq 142 aa AA seqDB search MKPPIALACLCLLVPLAGGNLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDW CCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNL NTYNRKYAHYPNKLCTGPTPPC NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgaaacctcccattgccctggcttgcctttgcctcctggtgcccctggctggcgggaac ctggtccagtttggagtgatgattgagagaatgacgggaaagcctgccctgcagtacaat gactatggctgctattgcggtgtcggtggctcccactggccagtggacgagacggattgg tgttgtcatgcccatgactgctgctatggccgcctggagaagctgggctgtgaccccaag ctggaaaagtacctcttctctatcactcgagacaacatcttctgtgctggtagaacggct tgccagcggcatacctgcgagtgtgacaagagagccgctctctgctttcgccacaacctg aacacttacaaccgcaagtatgcccactaccccaacaagctgtgtactgggcccacccca ccctgctga

DBGET integrated database retrieval system