Mus musculus (house mouse): 330122 Help Entry 330122            CDS       T01002                                  Symbol Cxcl3, Dcip1, Gm1960 Name (RefSeq) C-X-C motif chemokine ligand 3   KO K05505   C-X-C motif chemokine 1/2/3 Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04061   Viral protein interaction with cytokine and cytokine receptor mmu04062   Chemokine signaling pathway mmu04064   NF-kappa B signaling pathway mmu04621   NOD-like receptor signaling pathway mmu04657   IL-17 signaling pathway mmu04668   TNF signaling pathway mmu04936   Alcoholic liver disease mmu05134   Legionellosis mmu05146   Amoebiasis mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05323   Rheumatoid arthritis mmu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     330122 (Cxcl3)    04668 TNF signaling pathway     330122 (Cxcl3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     330122 (Cxcl3)    04061 Viral protein interaction with cytokine and cytokine receptor     330122 (Cxcl3)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     330122 (Cxcl3)    04657 IL-17 signaling pathway     330122 (Cxcl3)    04062 Chemokine signaling pathway     330122 (Cxcl3)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     330122 (Cxcl3)   09171 Infectious disease: bacterial    05134 Legionellosis     330122 (Cxcl3)   09174 Infectious disease: parasitic    05146 Amoebiasis     330122 (Cxcl3)   09163 Immune disease    05323 Rheumatoid arthritis     330122 (Cxcl3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     330122 (Cxcl3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     330122 (Cxcl3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     330122 (Cxcl3) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Chemokines    330122 (Cxcl3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  330122 NCBI-ProteinID:  NP_976065 MGI:  3037818 Ensembl:  ENSMUSG00000029379 UniProt:  Q6W5C0 LinkDB All DBs Position 5:90933960..90935952 Genome browser AA seq 100 aa AA seqDB search MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGP HCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcccctcccacctgccggctcctcagtgctgcactggtcctgctgctgctgctggcc accaaccaccaggctacaggggctgttgtggccagtgagctgcgctgtcagtgcctgaac accctaccaagggttgattttgagaccatccagagcttgacggtgacgcccccaggaccc cactgcacccagacagaagtcatagccactctcaaggatggtcaagaagtttgcctcaac ccccaaggccccaggcttcagataatcatcaagaagatactgaagagcggcaagtccagc tga

DBGET integrated database retrieval system