KEGG   Mus musculus (house mouse): 56489
Entry
56489             CDS       T01002                                 
Symbol
Ikbke, AW558201, IKK-E, IKK-i, IKKepsilon, Ikki
Name
(RefSeq) inhibitor of kappaB kinase epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04936  Alcoholic liver disease
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05207  Chemical carcinogenesis - receptor activation
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    56489 (Ikbke)
   04621 NOD-like receptor signaling pathway
    56489 (Ikbke)
   04622 RIG-I-like receptor signaling pathway
    56489 (Ikbke)
   04623 Cytosolic DNA-sensing pathway
    56489 (Ikbke)
   04625 C-type lectin receptor signaling pathway
    56489 (Ikbke)
   04657 IL-17 signaling pathway
    56489 (Ikbke)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    56489 (Ikbke)
  09172 Infectious disease: viral
   05161 Hepatitis B
    56489 (Ikbke)
   05160 Hepatitis C
    56489 (Ikbke)
   05171 Coronavirus disease - COVID-19
    56489 (Ikbke)
   05164 Influenza A
    56489 (Ikbke)
   05162 Measles
    56489 (Ikbke)
   05168 Herpes simplex virus 1 infection
    56489 (Ikbke)
   05167 Kaposi sarcoma-associated herpesvirus infection
    56489 (Ikbke)
   05169 Epstein-Barr virus infection
    56489 (Ikbke)
   05165 Human papillomavirus infection
    56489 (Ikbke)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    56489 (Ikbke)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    56489 (Ikbke)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    56489 (Ikbke)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     56489 (Ikbke)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   56489 (Ikbke)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like zf-RING_9
Other DBs
NCBI-GeneID: 56489
NCBI-ProteinID: NP_062751
MGI: 1929612
Ensembl: ENSMUSG00000042349
UniProt: Q9R0T8
LinkDB
Position
1:complement(131182337..131207339)
AA seq 717 aa
MQSTTNYLWHTDDLLGQGATASVYKARNKKSGEVVAVKVFNSASYRRPPEVQVREFEVLR
RLNHQNIVKLFAVEETGGSRQKVLIMEYCSSGSLLSVLEDPENTFGLSEEEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLSDFGAARKLDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAISGTQKQENGPLEWSYSLPITCRLSMGLQNQLVPILANILEVEEDKCWGFDQFFA
ETSDILQRTVIHVFSLPQAVLHHVYIHAHNTIAIFLEAVYEQTNVTPKHQEYLFEGHPCV
LEPSLSAQHIAHTAASSPLTLFSMSSDTPKGLAFRDPALDVPKFVPKVDLQADYSTAKGV
LGAGYQALWLARVLLDGQALMLRGLHWVLEVLQDTCQQTLEVTRTALLYLSSSLGTERFS
SGAGMPDVQERKEATELRTRLQTLSEILSKCSHNVTETQRSLSCLGEELLKNRDQIHEDN
KSIQKIQCCLDKMHFIYKQFKKSRMRPGLSYNEEQIHKLDKVNFSHLAKRLLQVFQEECV
QTYQVSLVTHGKRMRQVQRAQNHLHLIGHSVATCNSEARGAQESLNKIFDQLLLDRASEQ
GAEVSPQPMAPHPGPDPKDLVFHMQELCNDMKLLAFDLQDNNRLIERLHRVPSAPDV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgcagagtaccactaactacctgtggcatactgatgacctgctagggcagggggccact
gccagtgtgtacaaggcccgaaacaagaaatccggggaggtggttgctgtaaaggtcttc
aactcagccagctatcggcgacctcctgaggttcaggtgagggagtttgaggtcctgcgg
aggctgaatcaccagaacatcgtgaagctattcgcagtggaggaaacgggaggcagccgg
cagaaggtgctaatcatggagtactgctccagtgggagcctgctgagcgtgctggaagac
cctgagaacacgttcgggctttctgaagaggagttcctagtggtgctgcgctgtgtggtg
gctggcatgaaccacctgcgggagaatggcattgtccatcgggacatcaaacctgggaac
atcatgcgcctggtgggcgaggaggggcagagcatctataagctgtctgacttcggggct
gcccgcaagctggacgatgatgagaagtttgtttctgtctatggtacagaggaatacctg
caccctgacatgtatgagcgtgcagtgctgcgcaaaccccagcaaaaggcatttggtgtg
actgtggatctctggagtattggggtgaccctgtaccacgcagccacaggcagtctgccc
ttcatccccttcggtgggccccggcgcaacaaagagatcatgtacagaatcaccacagag
aagccagccggggccatttcagggactcagaagcaggaaaatggtcccttggagtggagc
tacagcctccccatcacctgtagactgtccatgggactgcagaaccagctggtgcccatc
ctggccaacatcctggaggtggaagaggataagtgctggggctttgatcagttcttcgcg
gagaccagtgacattctgcagcgaacggtcatccacgtcttttccctaccccaggccgtt
ttgcatcatgtctacatccacgcccacaacacgattgccatctttttggaggctgtatat
gagcagaccaacgtgacccccaaacaccaggagtacctcttcgagggtcacccttgtgtc
cttgagccaagcctctcagcccagcacatcgcccacacagctgccagcagccctctaact
ctgttcagcatgtccagcgacacacctaaggggctggccttcagggaccctgctctggat
gtcccaaagttcgtccctaaggttgacctacaggccgattacagcacagctaagggggtg
ctgggcgctggctaccaggccctgtggctggcgcgggtcctgctggatggacaggcgttg
atgcttcgggggttacattgggtcctggaggtgcttcaggacacgtgccagcagacactg
gaggtcacacggacagccctcctctacctcagcagcagcctgggcactgaaaggttcagc
agtggagcggggatgcctgacgtccaggaacgaaaggaggccacagagctaagaaccagg
ctgcagactctctcagagatcctgtctaaatgttcccacaatgtcacagaaacccaaagg
agcctgagctgtctgggtgaagagcttttaaagaaccgggaccagattcatgaggataac
aaaagtatccagaagattcagtgttgtttggacaagatgcacttcatctacaaacagttc
aagaaatccaggatgaggccagggctcagctacaatgaggagcagatccacaagctggat
aaggtaaatttcagtcatctagccaagaggctgctgcaggtgttccaggaggagtgtgtg
cagacgtatcaggtgtcgctggtcacacacggcaagcggatgaggcaggtgcagagggcc
cagaaccacctgcatctcattggccactctgtggccacctgtaactcggaagcccgggga
gcccaggagagtctgaacaagatctttgatcagctccttctggacagagcttccgaacag
ggagctgaggtgtcaccgcaacctatggctcctcatcccggccctgatccgaaggacctg
gtcttccacatgcaggagctttgtaatgatatgaagctattggcctttgatctccaggac
aacaaccgactcatcgaacggttacatagagttccatcggcaccagatgtctga

DBGET integrated database retrieval system