Mus musculus (house mouse): 69038 Help Entry 69038             CDS       T01002                                  Symbol Tmem258, 1810006K21Rik Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism mmu  Mus musculus (house mouse) Pathway mmu00510   N-Glycan biosynthesis mmu00513   Various types of N-glycan biosynthesis mmu04141   Protein processing in endoplasmic reticulum Module mmu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mmu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     69038 (Tmem258)    00513 Various types of N-glycan biosynthesis     69038 (Tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     69038 (Tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  69038 NCBI-ProteinID:  NP_081195 MGI:  1916288 Ensembl:  ENSMUSG00000036372 UniProt:  P61166 Q60FD1 LinkDB All DBs Position 19:10181566..10185188 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaagccatgagtaggtacaccagcccagtgaacccggctgtcttccctcac ctgactgtggtacttctggccatcggcatgttcttcactgcctggttcttcgtttacgag gtcacctctaccaagtacacacgcgatatttacaaagagctcctcatctccttggtggcc tcactcttcatgggctttggagtcctcttcctcctgctctgggttggcatctacgtataa

DBGET integrated database retrieval system