Mus musculus (house mouse): 69142 Help Entry 69142             CDS       T01002                                  Symbol Cd209f, 1810029C22Rik, SIGNR8 Name (RefSeq) CD209f antigen   KO K06563   C-type lectin domain family 4 member L/M Organism mmu  Mus musculus (house mouse) Pathway mmu03260   Virion - Human immunodeficiency virus mmu03264   Virion - Flavivirus and Alphavirus mmu03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mmu03273   Virion - Lassa virus and SFTS virus mmu04145   Phagosome mmu04625   C-type lectin receptor signaling pathway mmu05152   Tuberculosis mmu05162   Measles Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     69142 (Cd209f)    03264 Virion - Flavivirus and Alphavirus     69142 (Cd209f)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     69142 (Cd209f)    03273 Virion - Lassa virus and SFTS virus     69142 (Cd209f)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     69142 (Cd209f)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     69142 (Cd209f)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     69142 (Cd209f)   09171 Infectious disease: bacterial    05152 Tuberculosis     69142 (Cd209f)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     69142 (Cd209f)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mmu04054]     69142 (Cd209f)    04515 Cell adhesion molecules [BR:mmu04515]     69142 (Cd209f)    04090 CD molecules [BR:mmu04090]     69142 (Cd209f)    04091 Lectins [BR:mmu04091]     69142 (Cd209f) Membrane trafficking [BR:mmu04131]  Endocytosis   Phagocytosis    C-lectin receptors     69142 (Cd209f) Pattern recognition receptors [BR:mmu04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    69142 (Cd209f) Cell adhesion molecules [BR:mmu04515]  Lectins   Selectins and C-type lectins    69142 (Cd209f) CD molecules [BR:mmu04090]  Proteins   69142 (Cd209f) Lectins [BR:mmu04091]  C-Type lectins   Asialoglycoprotein and DC receptors    69142 (Cd209f) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C DASH_Dam1 UL45 Lectin_N Motif Other DBs NCBI-GeneID:  69142 NCBI-ProteinID:  NP_081232 MGI:  1916392 Ensembl:  ENSMUSG00000051906 UniProt:  G3UVT9 Q4KL16 LinkDB All DBs Position 8:complement(4152784..4155838) Genome browser AA seq 255 aa AA seqDB search MAGEPEFHQSKNHEEEVTSGEQGFAEHDPEGLICSSKSLQGHLTQVPWLLLLLISLGLFL LMLATLVQVSRIRAYSQGQTQDQQGSSSLDKVAVPREQTHSGLEQIQQIQQQLTQFNASL AGLCRPCPWDWELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSEQRFMKYWNVR KNQRSWIGLSDHIHEGSWQWVDGSALKFSFWKEGEPNNDGDEDCVELFMDDWNDNKCTEQ NFWVCEQPSAPCPHH NT seq 768 nt NT seq  +upstreamnt  +downstreamnt atggcaggagagccagagttccatcagtcaaagaatcatgaggaggaggtcacatctgga gagcagggatttgctgagcatgaccccgagggtctcatttgcagctccaagagtttacaa gggcatctgacccaagtcccctggcttctgctgcttctcatctctttgggcctctttttg cttatgttggccaccctggttcaagtctccaggattcgtgcatactcacagggacagacc caggatcagcagggtagctccagcttggacaaggttgccgttcctcgggagcagacacac tccggcttggagcagatccagcagattcagcagcagctgactcagttcaacgcctcgctg gctggcctgtgccggccctgtccctgggactgggagctcttccagggaagctgctacctc ttctccagaaccctgggcagctgggaaacctctgcctcctcctgcgaggatctcggggcc cacctggtgattgtcaacagtgtttcagagcagagattcatgaaatattggaatgtgagg aaaaaccaacgctcctggatcggcctcagtgaccatatacatgaaggttcctggcagtgg gtggacggcagcgccctcaagttcagcttttggaaagagggggaacctaacaatgacgga gatgaggactgcgtggagctgttcatggatgattggaatgataataagtgcactgaacag aacttttgggtctgtgagcagccctctgctccctgccctcatcactga

DBGET integrated database retrieval system