Mus musculus (house mouse): 70192 Help Entry 70192             CDS       T01002                                  Symbol Cd209g, 2310066I10Rik, SIGNR7 Name (RefSeq) CD209g antigen   KO K06563   C-type lectin domain family 4 member L/M Organism mmu  Mus musculus (house mouse) Pathway mmu03260   Virion - Human immunodeficiency virus mmu03264   Virion - Flavivirus and Alphavirus mmu03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mmu03273   Virion - Lassa virus and SFTS virus mmu04145   Phagosome mmu04625   C-type lectin receptor signaling pathway mmu05152   Tuberculosis mmu05162   Measles Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     70192 (Cd209g)    03264 Virion - Flavivirus and Alphavirus     70192 (Cd209g)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     70192 (Cd209g)    03273 Virion - Lassa virus and SFTS virus     70192 (Cd209g)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     70192 (Cd209g)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     70192 (Cd209g)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     70192 (Cd209g)   09171 Infectious disease: bacterial    05152 Tuberculosis     70192 (Cd209g)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     70192 (Cd209g)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mmu04054]     70192 (Cd209g)    04090 CD molecules [BR:mmu04090]     70192 (Cd209g)    04091 Lectins [BR:mmu04091]     70192 (Cd209g) Membrane trafficking [BR:mmu04131]  Endocytosis   Phagocytosis    C-lectin receptors     70192 (Cd209g) Pattern recognition receptors [BR:mmu04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    70192 (Cd209g) CD molecules [BR:mmu04090]  Proteins   70192 (Cd209g) Lectins [BR:mmu04091]  C-Type lectins   Asialoglycoprotein and DC receptors    70192 (Cd209g) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C DASH_Dam1 UL45 Motif Other DBs NCBI-GeneID:  70192 NCBI-ProteinID:  NP_081619 MGI:  1917442 Ensembl:  ENSMUSG00000079168 UniProt:  D3Z5D4 LinkDB All DBs Position 8:4184246..4187707 Genome browser AA seq 194 aa AA seqDB search MLATLVQVSRIRAYSQGQTQDQQGSSSLDKVAVPREQTHSGLEQIQQIQQQLTQFNASLA GLCRPCPWDWELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSEQQFLKYWHIRK NQLTWIGLSDHRSEGSWQWVDDTPLKLSFWKEGEPNNEGDEDCVVMAEDKWNDSRCTANN FWVCEQPSAPCPGY NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgttggccaccctggttcaagtctccaggattcgtgcatactcacagggacagacccag gatcagcagggtagctccagcttggacaaggttgccgttcctcgggagcagacacactcc ggcttggagcagatccagcagattcagcagcagctgactcagttcaacgcctcgctggct ggcctgtgccggccctgtccctgggactgggagctcttccagggaagctgctacctcttc tccagaaccctgggcagctgggaaacctctgcctcctcctgcgaggatctcggggcccac ctggtgattgtcaacagtgtttcagagcagcaattcctcaaatactggcacatcagaaag aatcagctcacctggatcggcctcagcgatcacagaagtgaaggttcctggcagtgggta gatgacaccccactcaaactcagcttctggaaagaaggggagcccaataatgaaggggac gaggactgcgtggtaatggcagaagataaatggaatgacagccgttgtactgcaaacaac ttctgggtctgtgagcagccctcggctccctgccctggttactga

DBGET integrated database retrieval system