KEGG   Mus musculus (house mouse): 74568
Entry
74568             CDS       T01002                                 
Symbol
Mlkl, 9130019I15Rik
Name
(RefSeq) mixed lineage kinase domain-like
  KO
K08849  mixed lineage kinase domain-like [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04217  Necroptosis
mmu04668  TNF signaling pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    74568 (Mlkl)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    74568 (Mlkl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    74568 (Mlkl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    74568 (Mlkl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     74568 (Mlkl)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  Other
   74568 (Mlkl)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase COG7 Kinase-like zf-MYND
Other DBs
NCBI-GeneID: 74568
NCBI-ProteinID: NP_001297542
MGI: 1921818
Ensembl: ENSMUSG00000012519
UniProt: Q9D2Y4
Structure
LinkDB
Position
8:complement(112037879..112065081)
AA seq 472 aa
MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAA
LGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHW
NTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQD
LQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEI
KTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVL
RAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTAKSTKAERSSS
TIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPV
GQDCPELLREIINECRAHEPSQRPSVDGRSLSGRERILERLSAVEESTDKKV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggataaattgggacagatcatcaagttaggccagctcatctatgaacagtgtgaaaag
atgaaatactgccggaaacaatgccagcgtctaggaaaccgtgtgcacggcctgctacag
cctctccagagactccaggcccaaggaaagaagaacctgcccgatgacattactgctgcc
ctgggccgttttgatgaagtcctgaaggaggctaaccagcagatagaaaagttcagcaag
aagtcccatatttggaagtttgtgagtgtgggcaatgataagatcctcttccatgaagtg
aatgagaagctgagagacgtctgggaggagctgttgctgctgcttcaggtttatcattgg
aataccgtttcagatgtcagccagccagcatcctggcagcaggaagatcgacaggatgca
gaggaagacggaaatgaaaatatgaaagttatcctgatgcagttgcaaattagcgtggaa
gaaatcaacaaaaccctgaagcaatgctcactaaaacccacacaggagatcccacaagat
ctccaaatcaaggagattccaaaggaacatcttggacctccgtggaccaaactgaagaca
agtaaaatgagcaccatttatagaggagagtatcacagatctccagttaccatcaaagta
ttcaacaacccccaggccgaaagtgttggaatagtgaggttcactttcaatgacgagatc
aaaaccatgaagaaattcgattctcccaacatcttgcgtatatttgggatttgcattgat
caaacagtgaagccccctgagttctccattgtcatggagtactgtgaacttggaaccctg
agggaactgctggatagagaaaaagacctcacaatgagtgtgcgcagcctcctagtcctg
agggcagccagaggcttatacaggctacaccattcggaaacactccacagaaacatcagc
agctccagtttcctcgtagccggaggctaccaagtaaagcttgcaggatttgagttaagc
aaaacacagaattccatcagccggacagcaaagagcactaaagcagagagatccagttca
acgatatatgtctcccctgagagactgaaaaatccattttgcctttatgacataaaagct
gaaatatatagctttggaattgtactctgggaaattgccactggaaagatcccatttgaa
ggctgtgattctaagaagatccgggagctggtggctgaggacaagaagcaggaaccagtg
ggtcaggattgccctgagttgttgcgggaaatcattaatgagtgtcgtgcccatgagccc
tcccaacggccctctgtggacggtaggagtctttctggcagagaacgaatcttggagaga
ctgtctgcggttgaagaatccacggacaagaaggtgtaa

DBGET integrated database retrieval system