Microcebus murinus (gray mouse lemur): 105858849 Help Entry 105858849         CDS       T07238                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur01522   Endocrine resistance mmur04010   MAPK signaling pathway mmur04024   cAMP signaling pathway mmur04210   Apoptosis mmur04380   Osteoclast differentiation mmur04620   Toll-like receptor signaling pathway mmur04657   IL-17 signaling pathway mmur04658   Th1 and Th2 cell differentiation mmur04659   Th17 cell differentiation mmur04660   T cell receptor signaling pathway mmur04662   B cell receptor signaling pathway mmur04668   TNF signaling pathway mmur04713   Circadian entrainment mmur04725   Cholinergic synapse mmur04728   Dopaminergic synapse mmur04915   Estrogen signaling pathway mmur04917   Prolactin signaling pathway mmur04921   Oxytocin signaling pathway mmur04926   Relaxin signaling pathway mmur04928   Parathyroid hormone synthesis, secretion and action mmur04932   Non-alcoholic fatty liver disease mmur04935   Growth hormone synthesis, secretion and action mmur05031   Amphetamine addiction mmur05132   Salmonella infection mmur05133   Pertussis mmur05135   Yersinia infection mmur05140   Leishmaniasis mmur05142   Chagas disease mmur05161   Hepatitis B mmur05162   Measles mmur05166   Human T-cell leukemia virus 1 infection mmur05167   Kaposi sarcoma-associated herpesvirus infection mmur05170   Human immunodeficiency virus 1 infection mmur05171   Coronavirus disease - COVID-19 mmur05200   Pathways in cancer mmur05207   Chemical carcinogenesis - receptor activation mmur05208   Chemical carcinogenesis - reactive oxygen species mmur05210   Colorectal cancer mmur05224   Breast cancer mmur05231   Choline metabolism in cancer mmur05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmur05323   Rheumatoid arthritis mmur05417   Lipid and atherosclerosis mmur05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105858849 (FOS)    04668 TNF signaling pathway     105858849 (FOS)    04024 cAMP signaling pathway     105858849 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105858849 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105858849 (FOS)    04660 T cell receptor signaling pathway     105858849 (FOS)    04658 Th1 and Th2 cell differentiation     105858849 (FOS)    04659 Th17 cell differentiation     105858849 (FOS)    04657 IL-17 signaling pathway     105858849 (FOS)    04662 B cell receptor signaling pathway     105858849 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     105858849 (FOS)    04917 Prolactin signaling pathway     105858849 (FOS)    04921 Oxytocin signaling pathway     105858849 (FOS)    04926 Relaxin signaling pathway     105858849 (FOS)    04935 Growth hormone synthesis, secretion and action     105858849 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     105858849 (FOS)   09156 Nervous system    04725 Cholinergic synapse     105858849 (FOS)    04728 Dopaminergic synapse     105858849 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     105858849 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     105858849 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105858849 (FOS)    05207 Chemical carcinogenesis - receptor activation     105858849 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     105858849 (FOS)    05231 Choline metabolism in cancer     105858849 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105858849 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     105858849 (FOS)    05224 Breast cancer     105858849 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105858849 (FOS)    05170 Human immunodeficiency virus 1 infection     105858849 (FOS)    05161 Hepatitis B     105858849 (FOS)    05171 Coronavirus disease - COVID-19     105858849 (FOS)    05162 Measles     105858849 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     105858849 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105858849 (FOS)    05135 Yersinia infection     105858849 (FOS)    05133 Pertussis     105858849 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105858849 (FOS)    05142 Chagas disease     105858849 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     105858849 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     105858849 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105858849 (FOS)    05418 Fluid shear stress and atherosclerosis     105858849 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105858849 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105858849 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmur03000]     105858849 (FOS)    04131 Membrane trafficking [BR:mmur04131]     105858849 (FOS) Transcription factors [BR:mmur03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105858849 (FOS) Membrane trafficking [BR:mmur04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105858849 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105858849 NCBI-ProteinID:  XP_012597704 Ensembl:  ENSMICG00000016026 UniProt:  A0A8C5VW39 LinkDB All DBs Position 3:22218181..22221654 Genome browser AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRGPHPYGVPTPSAGVYSRTGGVVKNMTGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLSDPEPKPSVEPVKSISSMELKAEPFDDFMFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPESDSFPSCAAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcgtcttcctcccgctgcagcagcgct tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg ggctctccggtcaatgcgcaggacttctgcacggacctggccgtctctagtgccaacttc atccccacggtgactgccatctctaccagtccagacctgcagtggctggtgcagcccact ttggtctcctccgtggccccatcgcagaccagaggcccccacccctacggagtccccacc ccctcggcgggggtttactctaggactggaggagttgtgaagaacatgacaggaggcaga gcccagagcattggcaggaggggcaaggtggaacagctatctccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagg gagctgaccgatacactccaagcggagacagaccaactggaagatgagaagtctgctctg cagactgagattgccaacctgctgaaggagaaggaaaagctagagttcatcctggcagct caccgccctgcctgcaagatccctgatgacttgggcttcccagaagagatgtctgtggct tcccttgatctgagtgggggcctgccggaggctgccaccccagagtctgaggaggccttt accctgcccctcctcagtgaccctgagcccaagccctcggtggagcccgtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcatgttcccagcatcgtccagg cccagcggctctgagacagcccgctctgtgccagacatggacttgtctggttccttctat gcagcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagag ctggagcccctgtgcaccccggtggtcacctgcactcccagctgcaccacttacacgtct tcctttgtcttcacctacccggagtctgactccttccccagctgcgcggctgcccaccgc aagggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system